Entry information : CpapAPx01 (evm.model.supercontig_139.46)
Entry ID 9168
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: CpapAPx01 (evm.model.supercontig_139.46)
Name (synonym) CpapAPx01 (evm.model.supercontig_139.46)
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx01
start..stop
S start..stop
GrAPx01 428 2e-154 1..250 1..250
MeAPx06 427 5e-154 1..250 1..250
PtriAPx01 426 2e-153 1..250 1..250
GhAPx02 425 3e-153 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 330137..330255 119 N° 2 330397..330571 175 N° 3 330660..330725 66 N° 4 331238..331372 135
N° 5 331475..331554 80 N° 6 331662..331764 103 N° 7 331879..331937 59 N° 8 332032..332047 16
join(330137..330255,330397..330571,330660..330725,331238..331372,331475..331554, 331662..331764,331879..331937,332032..332047)


exon

Literature and cross-references CpapAPx01 (evm.model.supercontig_139.46)
DNA ref. Phytozome 11:   supercontig_139 (330137..332047)
Protein sequence: CpapAPx01 (evm.model.supercontig_139.46)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27764.84  
PI (pH):   %s   6.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKQYPTVSEEYKKAVEKCTRKLRGFIAEKHCAPIMIRIAWHSAGTFDWKTKTGGPFGTMRCPAEQAHGANSGLDIAVNFLEPFKQQFPIISYADLYLAGVVATWVTGGPEIPFHPGREDKPEPPPEGRLPDATKGADHLRQVFGVQMGLTDKDIVALSGAHTLGKCHKERSGFEGRWTENHLIFDNSYFKELLSGEKEGLLQLPSDKCLVSDSAFRAYVEKYADEDAFFADYTEAFIKLSELGFADA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGCAGTACCCAACTGTTAGCGAGGAATACAAGAAGGCGGTAGAGAAATGCACTAGGAAACTCAGGGGCTTCATTGCCGAGAAGCACTGCGCTCCTATAATGATTCGTATCGCG
TATGAGCTTCATCTCCGTATCATATCTCTGAATACATGAATATATATCTAGTCAATGCCTATACGAACTTTGATATATGGTTGTTGTGTTAGTTTATGTGATTTAGAGGTTGTTGATGTG
ATTGTATTAATGTGATGCAGATGGCATTCTGCTGGAACTTTTGATTGGAAGACAAAAACCGGAGGCCCATTCGGTACCATGAGGTGCCCAGCAGAGCAGGCTCACGGGGCCAACAGTGGG
CTTGATATTGCTGTCAATTTTTTGGAGCCATTCAAGCAGCAGTTTCCTATCATCTCCTACGCTGACCTGTATCAG
GTAGTATGATGTCTTAATCTATTGTTTTAAAAATATTGTTTGTTT
GAGTTTTTAGAATTGGCTATTAATTATTTTTGATCCGGTGTAGCTTGCTGGTGTTGTTGCCACTTGGGTTACCGGAGGTCCGGAAATTCCTTTCCATCCTGGAAGAGAGGTCAGCTTTTT
TTTTGCTTTTTTTTCCCTTTTCAACCCTCGTCAACTATTAACATTGCGGGGCTCTTTAAAGACGCCTACTGCTTGCTCTGTATGGGTGTATCAGTTGGTTTTCTCTAATTAAATGTGGAG
GTGTTTGCTTAATCGTTGACACTTGTCTGAATTGTATAAAATCAGGCTTGCAAATTACTTTTTCAATGTTGCGTTCGTTCAGTTCTTCATATCAATATCTAACTTGTCGATACGTTGTTG
ATTTAGTTCATGTCTGATGTTGATTGCTGTGTGCTGATATGTTGCGGATATATCCATGGTTAATGTTGATATATGTTCTTTATGTTGTCTTTTCGATTCTAAACAATTTGTTACTAATGT
GTAATTGGCAGAAAGATGTTCATCAACGTCCTTGGGTTGTTGTATTCTAATGCTTTTGCAATCAATTATGCACTTTTTGCTTCAAATAGTCACTCTCCAATATATTGATGGTACTGATAA
CTATGTTCCTCTGCATTTCAGGATAAACCTGAGCCACCTCCGGAGGGCCGTTTACCTGATGCCACTAAAGGTGCTGACCACTTGAGGCAGGTGTTTGGTGTGCAAATGGGTCTCACCGAC
AAGGACATTGTTGCTTTATCCGGTGCCCACACCTTG
GTTTGTGCCAAGCATACCAAATATTTCTTCCCCTTTCTGAGTCAACGCAATGCTCTCATTTCTAAACTTATTGATTTGGAATGT
GTTTTTTTATTTTTCCAGGGAAAGTGCCACAAGGAAAGGTCTGGTTTTGAGGGCCGTTGGACTGAAAATCATCTCATATTCGATAACTCTTACTTCAAGTGAGTTGACAGTCTTCTTAAT
TTCATCTTCTTTTTCTATATCCTGCATCTTAAACATTAGAGTGTGTTTGATAACATCTCCTTTAACTTAAACAAACACTGAACAGGGAGCTCTTGAGCGGAGAGAAGGAAGGCCTCCTAC
AGCTACCATCTGACAAATGTCTTGTATCAGACTCTGCATTCCGCGCTTATGTTGAAAAATATGCTGCA
GTATGTGATTTTTTTTTATTAATCTTTAATTGTTTTGTCCTAAATTTTTGGT
GTATTATACCCTATTTGAAAGTCCCCGGATTTTATTATGCTTGGTTAATTCATCTTCTGCAGGATGAGGATGCTTTCTTTGCCGACTATACTGAGGCTTTTATTAAGCTCTCTGAGCTGG
G
GTAATTTCATTGTTCATAGTTGATTGATAGTTCTAATGCACATACATTTTAAAAGCTTGATTGCTAAGATATTAATATTCCTCTGATTGTGCAGATTTGCTGACGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGCAGTACCCAACTGTTAGCGAGGAATACAAGAAGGCGGTAGAGAAATGCACTAGGAAACTCAGGGGCTTCATTGCCGAGAAGCACTGCGCTCCTATAATGATTCGTATCGCA
TGGCATTCTGCTGGAACTTTTGATTGGAAGACAAAAACCGGAGGCCCATTCGGTACCATGAGGTGCCCAGCAGAGCAGGCTCACGGGGCCAACAGTGGGCTTGATATTGCTGTCAATTTT
TTGGAGCCATTCAAGCAGCAGTTTCCTATCATCTCCTACGCTGACCTGTATCAG
CTTGCTGGTGTTGTTGCCACTTGGGTTACCGGAGGTCCGGAAATTCCTTTCCATCCTGGAAGAGAG
GATAAACCTGAGCCACCTCCGGAGGGCCGTTTACCTGATGCCACTAAAGGTGCTGACCACTTGAGGCAGGTGTTTGGTGTGCAAATGGGTCTCACCGACAAGGACATTGTTGCTTTATCC
GGTGCCCACACCTTG
GGAAAGTGCCACAAGGAAAGGTCTGGTTTTGAGGGCCGTTGGACTGAAAATCATCTCATATTCGATAACTCTTACTTCAAGGAGCTCTTGAGCGGAGAGAAGGAA
GGCCTCCTACAGCTACCATCTGACAAATGTCTTGTATCAGACTCTGCATTCCGCGCTTATGTTGAAAAATATGCTGCA
GATGAGGATGCTTTCTTTGCCGACTATACTGAGGCTTTTATT
AAGCTCTCTGAGCTGGG
ATTTGCTGACGCTTAA

Retrieve as FASTA