Entry information : MguPrx02 ( mgv11b018535m)
Entry ID 9170
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-18 (Christophe Dunand)
Peroxidase information: MguPrx02 ( mgv11b018535m)
Name (synonym) MguPrx02 ( mgv11b018535m)
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx02
start..stop
S start..stop
MguPrx22 556 0 8..325 15..333
MguPrx108 556 0 1..325 10..333
MguPrx27 491 7e-177 7..325 11..331
MguPrx29 491 2e-176 8..325 11..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71984..72199 216 N° 2 71095..71880 786  
complement(join(71095..71880,71984..72199))


exon

Literature and cross-references MguPrx02 ( mgv11b018535m)
DNA ref. Phytozome 12:   scaffold_16 (72199..71095)
Protein sequence: MguPrx02 ( mgv11b018535m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (315)
PWM (Da):   %s   36194.72 (34090.5)  
PI (pH):   %s   8.47 (8.38) Peptide Signal:   %s   cut: 20 range:20-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIINGRLLLISCFILFVSAADNSTPGLVVGFYKNSCPIAEITVRKYVERFVTLNPGFAAGLIRMHFHDCFVRGCDASVLLDGNNSEKQSIPNKGSLRGFEIIDAAKAELELKCPGIVSCADILAFSARDSASRVGNIYYEVPAGRRDGNVSNTLDPLLNLPPPFFDATSLRDNFARKGLSLDEMVTLSGAHSIGIAHCTSFLGRLYPTVDPTLDPKYAAKLRKICKAPVANATGPPKVNPTVDQDTITPNRLDNLYYLGLKQKKGLFKSDQDLMTSPLTSNIVLNNIQFGLVWADKFGAAMVKMGNIDVLTGNQGEVRLNCRLVNTVGVNTMRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAATTAATGGGCGGTTGCTTCTGATCTCTTGCTTCATTTTGTTTGTTTCAGCCGCTGATAATTCAACCCCGGGCCTTGTAGTTGGCTTCTACAAAAACTCTTGTCCCATTGCGGAA
ATCACTGTCCGAAAATACGTCGAAAGATTCGTCACTTTAAACCCTGGTTTTGCTGCTGGCCTTATCAGGATGCACTTCCACGATTGCTTCGTCAGG
GTATATATTATATAATTCGTTTAA
TTTAGATATTATAATCTTCTTTTTGTTTAATATAATTCCCATATCGATCTATCTATATGTGGTTTTAATTACATTACAGGGTTGTGATGCTTCTGTATTGTTGGATGGAAACAACTCGGA
AAAGCAAAGTATACCAAACAAGGGAAGCCTAAGAGGTTTCGAAATAATAGACGCAGCAAAAGCCGAACTAGAGCTGAAATGCCCTGGAATCGTGTCATGTGCAGACATTCTTGCATTCTC
AGCCAGAGACAGCGCCTCGAGAGTTGGCAACATTTACTACGAAGTCCCCGCTGGACGCCGTGACGGAAATGTTTCCAACACACTTGACCCACTTTTAAATCTTCCCCCACCTTTCTTCGA
CGCCACTTCTCTCAGAGACAATTTTGCCAGAAAGGGTCTCTCGCTCGACGAAATGGTGACGCTTTCAGGGGCCCACTCCATCGGAATTGCTCATTGCACTTCCTTTTTAGGCCGTCTATA
CCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAGAAAGATATGCAAAGCGCCTGTTGCTAATGCGACCGGTCCACCGAAAGTGAACCCCACAGTCGATCAGGATAC
GATCACTCCAAATCGCTTGGACAATTTATACTACTTGGGATTGAAACAGAAAAAGGGGCTTTTTAAGTCGGATCAGGATCTTATGACAAGCCCTTTGACTTCCAATATTGTGCTCAACAA
TATTCAGTTTGGTCTTGTTTGGGCAGACAAGTTTGGCGCTGCCATGGTCAAGATGGGCAACATTGATGTTCTCACCGGCAACCAAGGCGAGGTCAGGCTAAATTGCCGTCTTGTCAATAC
TGTTGGGGTTAATACCATGAGAAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAATTAATGGGCGGTTGCTTCTGATCTCTTGCTTCATTTTGTTTGTTTCAGCCGCTGATAATTCAACCCCGGGCCTTGTAGTTGGCTTCTACAAAAACTCTTGTCCCATTGCGGAA
ATCACTGTCCGAAAATACGTCGAAAGATTCGTCACTTTAAACCCTGGTTTTGCTGCTGGCCTTATCAGGATGCACTTCCACGATTGCTTCGTCAGG
GGTTGTGATGCTTCTGTATTGTTG
GATGGAAACAACTCGGAAAAGCAAAGTATACCAAACAAGGGAAGCCTAAGAGGTTTCGAAATAATAGACGCAGCAAAAGCCGAACTAGAGCTGAAATGCCCTGGAATCGTGTCATGTGCA
GACATTCTTGCATTCTCAGCCAGAGACAGCGCCTCGAGAGTTGGCAACATTTACTACGAAGTCCCCGCTGGACGCCGTGACGGAAATGTTTCCAACACACTTGACCCACTTTTAAATCTT
CCCCCACCTTTCTTCGACGCCACTTCTCTCAGAGACAATTTTGCCAGAAAGGGTCTCTCGCTCGACGAAATGGTGACGCTTTCAGGGGCCCACTCCATCGGAATTGCTCATTGCACTTCC
TTTTTAGGCCGTCTATACCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAGAAAGATATGCAAAGCGCCTGTTGCTAATGCGACCGGTCCACCGAAAGTGAACCCC
ACAGTCGATCAGGATACGATCACTCCAAATCGCTTGGACAATTTATACTACTTGGGATTGAAACAGAAAAAGGGGCTTTTTAAGTCGGATCAGGATCTTATGACAAGCCCTTTGACTTCC
AATATTGTGCTCAACAATATTCAGTTTGGTCTTGTTTGGGCAGACAAGTTTGGCGCTGCCATGGTCAAGATGGGCAACATTGATGTTCTCACCGGCAACCAAGGCGAGGTCAGGCTAAAT
TGCCGTCTTGTCAATACTGTTGGGGTTAATACCATGAGAAAA

Retrieve as FASTA