Entry information : MguPrx100 (mgv1a025851m)
Entry ID 9175
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx100 (mgv1a025851m)
Name (synonym) MguPrx100 (mgv1a025851m)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx100
start..stop
S start..stop
AmajPrx05 514 0 3..318 26..338
PatrPrx68 507 0 3..318 9..322
PtPrx68 507 0 3..318 9..322
PbPrx68 506 0 3..318 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3115325..3115525 201 N° 2 3114974..3115165 192 N° 3 3114637..3114802 166 N° 4 3113829..3114223 395
complement(join(3113829..3114223,3114637..3114802,3114974..3115165,3115325..3115 525))


exon

Literature and cross-references MguPrx100 (mgv1a025851m)
DNA ref. Phytozome 12:   scaffold_8 (3115525..3113829)
Protein sequence: MguPrx100 (mgv1a025851m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (298)
PWM (Da):   %s   33994.2 (31983.2)  
PI (pH):   %s   9.17 (9.34) Peptide Signal:   %s   cut: 21 range:21-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFCTLAIVLVFLIGSSSAQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILGGPDWKVKLGRRDSRTASLAAANNSIPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTIGQARCTSFRARIYNETNLDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFKNLISRRGLLHSDQQLFSGSGGRTDSIVRSYSSDSATFRSDFAAAMIKMGDIKPVTGSNGEIRKNCRIL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATTTTGTACTTTGGCAATTGTACTTGTCTTCCTAATAGGAAGCTCCTCAGCTCAACTCTCCACTGATTATTACTCTAAATCTTGCCCTAATCTTTTCACCACCGTAAAAACC
GTCGTTCGTTCTGCTATTCAAAACGAGGCTCGCATGGGCGCCTCCCTCCTCCGTCTTTTCTTCCACGATTGCTTCGTTAAC
GTAAATTTTCTTATTATTAATTTCTCATATATTTATCTC
ATCATTTAATTTATAAATATTCCCTGTTGTATCAACTAATTCCACATTACACTAAGTTGTATGAGTCAATGAATAGTTGACCCTATATCAATCAAAAATGTATTTTTTTTATTTGCCTAG

GGATGTGATGGATCAATCCTCCTGGATGACACATCATCATTCACCGGGGAGAAGACGGCCCTTCCGAATCGGAACTCTGTCAGGGGATTTAACATCGTCGACAATATTAAATCAGCGGTG
GAAAAGGTGTGCCCTAATGTTGTCTCTTGCGCCGACATCTTGGCCGTCGCTTCTCGCGACTCGGTTGTCATC
GTAAGTTCCCTCACATAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATTGGTTTGGGAAATTGGATGCATG
CAGCTAGGAGGGCCTGATTGGAAAGTAAAATTGGGAAGAAGGGATTCAAGAACAGCAAGCCTTGCTGCTGCAAACAACAGCATTCCTCCACCTACTTCAAATCTCAATACCCTAATTTCA
AGTTTCAATTCACTTGGTCTTTCAACCAAGGACTTAGTTGTCCTTTCAG
GTTTTTCCTTTCTCAAATAAACATATTAATTAAATTAAATTCATTTCTGCAATNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAAAAAAAACACATGCATGCATGCAGGTTCTCACACAATCGGAC
AAGCAAGGTGCACAAGCTTCAGAGCTCGAATATACAACGAAACAAATTTAGACGCTTCTTTCGCGCAAACTCGACGGGGTAACTGCCCGAGAGCCGCCGGCGCCGGAGACAACAACTTGG
CCCCGTTGGATGTCCAGACGCCGGCGAACTTCGACAACAACTACTTCAAGAACCTCATCAGCCGCCGCGGCTTACTCCACTCCGACCAGCAGCTGTTCAGCGGCAGCGGCGGACGCACCG
ACTCAATTGTCCGATCGTACAGCAGTGATTCCGCCACCTTCCGATCAGATTTCGCCGCAGCTATGATCAAGATGGGTGATATTAAACCCGTCACCGGATCTAATGGTGAAATAAGGAAAA
ATTGCAGGATCCTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATTTTGTACTTTGGCAATTGTACTTGTCTTCCTAATAGGAAGCTCCTCAGCTCAACTCTCCACTGATTATTACTCTAAATCTTGCCCTAATCTTTTCACCACCGTAAAAACC
GTCGTTCGTTCTGCTATTCAAAACGAGGCTCGCATGGGCGCCTCCCTCCTCCGTCTTTTCTTCCACGATTGCTTCGTTAAC
GGATGTGATGGATCAATCCTCCTGGATGACACATCATCA
TTCACCGGGGAGAAGACGGCCCTTCCGAATCGGAACTCTGTCAGGGGATTTAACATCGTCGACAATATTAAATCAGCGGTGGAAAAGGTGTGCCCTAATGTTGTCTCTTGCGCCGACATC
TTGGCCGTCGCTTCTCGCGACTCGGTTGTCATC
CTAGGAGGGCCTGATTGGAAAGTAAAATTGGGAAGAAGGGATTCAAGAACAGCAAGCCTTGCTGCTGCAAACAACAGCATTCCTCCA
CCTACTTCAAATCTCAATACCCTAATTTCAAGTTTCAATTCACTTGGTCTTTCAACCAAGGACTTAGTTGTCCTTTCAG
GTTCTCACACAATCGGACAAGCAAGGTGCACAAGCTTCAGA
GCTCGAATATACAACGAAACAAATTTAGACGCTTCTTTCGCGCAAACTCGACGGGGTAACTGCCCGAGAGCCGCCGGCGCCGGAGACAACAACTTGGCCCCGTTGGATGTCCAGACGCCG
GCGAACTTCGACAACAACTACTTCAAGAACCTCATCAGCCGCCGCGGCTTACTCCACTCCGACCAGCAGCTGTTCAGCGGCAGCGGCGGACGCACCGACTCAATTGTCCGATCGTACAGC
AGTGATTCCGCCACCTTCCGATCAGATTTCGCCGCAGCTATGATCAAGATGGGTGATATTAAACCCGTCACCGGATCTAATGGTGAAATAAGGAAAAATTGCAGGATCCTCAAT

Retrieve as FASTA