Entry information : MguPrx101 (mgv1a025866m)
Entry ID 9176
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx101 (mgv1a025866m)
Name (synonym) MguPrx101 (mgv1a025866m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx101
start..stop
S start..stop
MguPrx73 578 0 1..324 4..314
PpePrx78 429 2e-152 5..324 7..322
StPrx20 427 9e-152 3..324 8..322
PpePrx73 425 6e-151 5..324 7..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 798878..799087 210 N° 2 798159..798350 192 N° 3 797832..797997 166 N° 4 796628..797031 404
complement(join(796628..797031,797832..797997,798159..798350,798878..799087))


exon

Literature and cross-references MguPrx101 (mgv1a025866m)
DNA ref. Phytozome 12:   scaffold_92 (799087..796628)
Protein sequence: MguPrx101 (mgv1a025866m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34608.1 (32058.7)  
PI (pH):   %s   4.37 (4.30) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVPIATFLVLIFVTVFEKGCNAQLSTTFYATTCPNISSVVLNVIQQAQRADVRAAPKLIRLHFHDCFVDGCDGSLLLDNADGILSEKDAFPNAGSVDGFGIVDNMKTALESVCPGVVSCADILALASQISVNLVGGPSYSVPLGRRDGRTANRAGANTELPSPFANLDELRSNFSAKGLDSTDLVALSGAHTFGRAKCNTFSHRLYNFANSGGPDQTIEPTYLETLRQTCPQNGAGTTLENLDQSTPDEFDNEYFENLQSGKGLLQTDQLLFSSTGSDTVAIVDRFGDSETEFFDAFVRSIIKMGNIAPLTGTQGEIRADCK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGCCAATAGCAACTTTTCTCGTGCTGATATTCGTAACTGTGTTCGAAAAAGGATGCAACGCTCAGTTGAGCACCACATTCTACGCTACCACGTGCCCTAATATATCGAGCGTG
GTTCTTAATGTCATCCAACAGGCTCAACGGGCTGATGTTCGGGCTGCCCCTAAACTTATTCGCCTTCATTTCCATGATTGCTTCGTCGAT
GTAAATTTTCCATCTCTATTTTTTCCCTCT
TTTTTTCTAGGGTTATTAGGGATCGGCATGCATGTGTTAAAATCTAGAAGAGCCACAAATATATATATATGTTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTCCCGATATGTACATATCGA
AATTTATAAAAATTAGTGTTAATAAACAATAACAATAGACAATTAGTTAATATTGTCTCCGAAATCTCAGGATGGATATTCCGGTGGTTATATATTTGAATGGGTGAAGTACTAATTTGT
TTGTGTTCATTCGTCAGGGCTGCGATGGATCGCTTTTGCTAGACAATGCAGACGGCATACTCAGCGAAAAAGACGCGTTCCCGAATGCTGGTTCTGTCGACGGATTCGGTATAGTAGATA
ACATGAAAACAGCCTTGGAGAGTGTGTGCCCAGGTGTGGTCTCGTGTGCAGATATTTTGGCACTAGCTTCTCAAATTTCAGTTAACTTG
GTAACTACATACAAATAATTAATCTTTATTT
CATGCGCATAAGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAATATGGTATTANNNNNNNNNNNNN
NNNNNNNNNGGTAGGAGGTCCATCATATTCAGTACCACTAGGAAGAAGAGATGGCAGAACAGCAAACAGAGCAGGGGCAAATACGGAACTTCCAAGCCCTTTTGCCAACCTTGATGAACT
CCGATCCAATTTCAGCGCCAAGGGTCTCGACTCTACTGACTTGGTCGCTCTATCAG
GTATACTTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTATCANNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTACAAGATGAAATATTAATCATGAAAAAACACAAA
TCCAAATTCAAGATTTTGAATACATATTTTTACTATATGGTGCAACTCAGACTTGCACTAGACGTTATTTTTGTTCCTCATATTCGTCTTATAAGTAAAATACTAATCCTTTTTTTTTTC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTATA
TATATCGTAATCTCAGGTGCGCATACATTTGGGCGTGCAAAATGCAACACATTCAGCCACAGGCTCTACAACTTCGCCAACTCCGGTGGGCCCGACCAAACCATAGAACCTACTTACCTG
GAAACGTTGCGACAAACGTGCCCTCAAAACGGCGCCGGAACCACCTTAGAAAATCTTGACCAGTCAACGCCCGACGAATTCGACAACGAATACTTTGAAAATCTGCAGAGCGGGAAAGGC
CTTCTTCAGACCGATCAACTATTGTTCTCTTCTACTGGATCCGATACAGTTGCTATTGTTGACCGGTTCGGTGATAGCGAAACCGAGTTTTTCGATGCTTTCGTCCGGTCCATTATTAAA
ATGGGCAACATTGCCCCGCTCACCGGAACTCAGGGAGAGATCCGAGCTGATTGCAAGAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTGCCAATAGCAACTTTTCTCGTGCTGATATTCGTAACTGTGTTCGAAAAAGGATGCAACGCTCAGTTGAGCACCACATTCTACGCTACCACGTGCCCTAATATATCGAGCGTG
GTTCTTAATGTCATCCAACAGGCTCAACGGGCTGATGTTCGGGCTGCCCCTAAACTTATTCGCCTTCATTTCCATGATTGCTTCGTCGAT
GGCTGCGATGGATCGCTTTTGCTAGACAAT
GCAGACGGCATACTCAGCGAAAAAGACGCGTTCCCGAATGCTGGTTCTGTCGACGGATTCGGTATAGTAGATAACATGAAAACAGCCTTGGAGAGTGTGTGCCCAGGTGTGGTCTCGTGT
GCAGATATTTTGGCACTAGCTTCTCAAATTTCAGTTAACTTG
GTAGGAGGTCCATCATATTCAGTACCACTAGGAAGAAGAGATGGCAGAACAGCAAACAGAGCAGGGGCAAATACGGAA
CTTCCAAGCCCTTTTGCCAACCTTGATGAACTCCGATCCAATTTCAGCGCCAAGGGTCTCGACTCTACTGACTTGGTCGCTCTATCAG
GTGCGCATACATTTGGGCGTGCAAAATGCAAC
ACATTCAGCCACAGGCTCTACAACTTCGCCAACTCCGGTGGGCCCGACCAAACCATAGAACCTACTTACCTGGAAACGTTGCGACAAACGTGCCCTCAAAACGGCGCCGGAACCACCTTA
GAAAATCTTGACCAGTCAACGCCCGACGAATTCGACAACGAATACTTTGAAAATCTGCAGAGCGGGAAAGGCCTTCTTCAGACCGATCAACTATTGTTCTCTTCTACTGGATCCGATACA
GTTGCTATTGTTGACCGGTTCGGTGATAGCGAAACCGAGTTTTTCGATGCTTTCGTCCGGTCCATTATTAAAATGGGCAACATTGCCCCGCTCACCGGAACTCAGGGAGAGATCCGAGCT
GATTGCAAGAGG

Retrieve as FASTA