Entry information : MguPrx11 (mgv1a009174m[1.1])
Entry ID 9181
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: MguPrx11 (mgv1a009174m[1.1])
Name (synonym) MguPrx11 (mgv1a009174m[1.1])
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx11
start..stop
S start..stop
PtPrx67 521 0 9..343 11..348
FvPrx01 519 0 3..343 6..350
PpePrx02 510 0 9..343 14..352
LjPrx02 508 0 1..329 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 567779..568012 234 N° 2 568137..568331 195 N° 3 568693..569316 624  
join(567779..568012,568137..568331,568693..569316)


exon

Literature and cross-references MguPrx11 (mgv1a009174m[1.1])
DNA ref. Phytozome 12:   scaffold_98 (567779..569316)
Protein sequence: MguPrx11 (mgv1a009174m[1.1])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (324)
PWM (Da):   %s   37760.19 (34822.6)  
PI (pH):   %s   7.4 (7.72) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSISLLLLLSSSLLLHSYFQYAEAQQVADGLSWSFYNSSCPNLESIVRKQLKKVFKNDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPSEQTAPPNLSLRAEAFKIIDDLRRRVHKKCGGIVSCADILALASRDSIFLSGGPDYNVPLGRRDGLDFATIAATLANLPAPSSNTTTLLESLGTKGFTATDVVALSGGHTIGIGHCSSFTGRLYPNQDPVMDKTFARNLKTICPAPNSNNTTQLDLRSPNIFDNKYYVDLMNRQGLFTSDQDLYQDSRTRAIVTSFAANQTIFFENFVTAVVKMSQLNVLTGAQGEIRANCSARNSGSLLLSPVVVAGEEKELRSTV*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTATTTCTCTACTGTTATTGCTGTCCAGTTCCCTCCTTTTACACTCATATTTTCAGTATGCAGAAGCTCAACAAGTTGCTGATGGACTTTCATGGAGTTTCTACAATTCT
TCATGTCCTAACTTGGAATCCATTGTAAGAAAACAGCTGAAAAAAGTGTTCAAGAACGACATCGGACAAGCCGCTGGATTGCTTCGTCTCCATTTCCATGATTGCTTCGTCCAG
GTATGC
ATACATATATATACATTATTACTCTTTAGTTGATAAAAACAAGTTCTTGAAATTGCTCTTTGCATACATCATGCTTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAATGCAGGG
GTGTGATGGTTCGGTGCTGCTAGATGGATCGGCAAGTGGGCCGAGCGAACAGACGGCACCACCCAATTTGAGCCTGAGGGCCGAGGCCTTCAAAATCATCGACGATCTTCGAAGACGTGT
GCATAAAAAGTGCGGTGGAATCGTCTCTTGTGCAGATATTCTCGCTCTCGCCTCCCGTGATTCTATTTTTCTA
GTAAGTTGTTTAAATCTACGTATGCGTATTATCTTTCGAATTTTTCT
TGTTTCGAGTTAGATGATTATGGATTATTACTAGTAGTTGATTCTTTAATGCACATTTATTTCGTTTCACCGGCAAACTAGCTGAGGCCCCCCAGCTGANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACAGTCTGGCGGGCCCGACTACAACGTTCCCCTAGGCCGACGCGACGGCC
TCGATTTCGCCACCATCGCTGCCACGTTGGCAAACCTTCCGGCACCATCGAGCAACACCACCACCCTCCTCGAGTCTCTTGGGACCAAGGGCTTCACCGCCACCGACGTGGTGGCGCTCT
CCGGCGGACACACCATCGGAATCGGCCACTGCAGCTCCTTCACCGGCCGCCTCTACCCCAACCAAGACCCCGTCATGGACAAAACATTCGCCAGAAACCTCAAAACCATTTGCCCCGCGC
CCAACTCGAACAACACAACTCAACTCGACCTTCGGTCGCCAAACATATTTGACAACAAATACTACGTGGATCTAATGAACAGACAGGGGCTTTTCACCTCGGACCAGGATTTGTACCAGG
ATTCTCGGACAAGAGCCATCGTCACGAGTTTCGCGGCTAACCAGACGATTTTTTTCGAGAATTTTGTGACCGCTGTCGTGAAAATGTCGCAGTTGAACGTGTTGACCGGGGCGCAGGGGG
AGATTCGTGCGAATTGCTCCGCTAGGAATTCGGGCAGTCTGTTGCTTTCTCCGGTGGTGGTCGCCGGAGAGGAGAAGGAGCTCCGGTCGACGGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTATTTCTCTACTGTTATTGCTGTCCAGTTCCCTCCTTTTACACTCATATTTTCAGTATGCAGAAGCTCAACAAGTTGCTGATGGACTTTCATGGAGTTTCTACAATTCT
TCATGTCCTAACTTGGAATCCATTGTAAGAAAACAGCTGAAAAAAGTGTTCAAGAACGACATCGGACAAGCCGCTGGATTGCTTCGTCTCCATTTCCATGATTGCTTCGTCCAG
GGGTGT
GATGGTTCGGTGCTGCTAGATGGATCGGCAAGTGGGCCGAGCGAACAGACGGCACCACCCAATTTGAGCCTGAGGGCCGAGGCCTTCAAAATCATCGACGATCTTCGAAGACGTGTGCAT
AAAAAGTGCGGTGGAATCGTCTCTTGTGCAGATATTCTCGCTCTCGCCTCCCGTGATTCTATTTTTCTA
TCTGGCGGGCCCGACTACAACGTTCCCCTAGGCCGACGCGACGGCCTCGAT
TTCGCCACCATCGCTGCCACGTTGGCAAACCTTCCGGCACCATCGAGCAACACCACCACCCTCCTCGAGTCTCTTGGGACCAAGGGCTTCACCGCCACCGACGTGGTGGCGCTCTCCGGC
GGACACACCATCGGAATCGGCCACTGCAGCTCCTTCACCGGCCGCCTCTACCCCAACCAAGACCCCGTCATGGACAAAACATTCGCCAGAAACCTCAAAACCATTTGCCCCGCGCCCAAC
TCGAACAACACAACTCAACTCGACCTTCGGTCGCCAAACATATTTGACAACAAATACTACGTGGATCTAATGAACAGACAGGGGCTTTTCACCTCGGACCAGGATTTGTACCAGGATTCT
CGGACAAGAGCCATCGTCACGAGTTTCGCGGCTAACCAGACGATTTTTTTCGAGAATTTTGTGACCGCTGTCGTGAAAATGTCGCAGTTGAACGTGTTGACCGGGGCGCAGGGGGAGATT
CGTGCGAATTGCTCCGCTAGGAATTCGGGCAGTCTGTTGCTTTCTCCGGTGGTGGTCGCCGGAGAGGAGAAGGAGCTCCGGTCGACGGTCTAG

Retrieve as FASTA