Entry information : MguPrx13 (mgv1a009228m)
Entry ID 9183
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx13 (mgv1a009228m)
Name (synonym) MguPrx13 (mgv1a009228m)
Class Class III peroxidase    [Orthogroup: Prx032]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx13
start..stop
S start..stop
VvPrx53 551 0 30..347 28..346
CsPrx13 551 0 14..347 22..355
CclPrx92 551 0 16..347 25..356
CppPrx08 550 0 14..347 21..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3402947..3403210 264 N° 2 3402637..3402837 201 N° 3 3401707..3402285 579  
complement(join(3401707..3402285,3402637..3402837,3402947..3403210))


exon

Literature and cross-references MguPrx13 (mgv1a009228m)
DNA ref. Phytozome 12:   scaffold_4 (3403210..3401707)
Protein sequence: MguPrx13 (mgv1a009228m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (319)
PWM (Da):   %s   38153.43 (34969.7) Transmb domain:   %s   o10-32i
PI (pH):   %s   8.84 (8.84) Peptide Signal:   %s   cut: 30 range:30-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSYFSSPPPPILTFFIFLLSLLSLSLSNAALTTTPKVSARYQLSVDYYAKKCPQLDQLVASVTSQQFQEAPISGPATIRLFFHDCFVEGCDASILISSKPGNKELAERDAEENKDMAPDAYDSINKAKSLVESKCPGVVSCADILAIAARDFVHLAGGPYYQVKKGRWDGKLSMASRVQSNLPRSNSTVDELIKLFKSKGLTIEDLVILSGAHTIGFAHCKHFVSRLYDYKGTKQPDPSVDPRLLKALKMSCPNYGGNTDIVAPFDVTTPFSFDNAYYGNLEAKMGLLASDQALFVDPRTNGLVQTMAKDKQKFFQAFALAMEKMGSIGVKRGRRHGEKRKDCSVHMG

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTATTTCTCCTCTCCTCCTCCTCCAATTCTCACATTCTTCATCTTTCTTCTCTCACTACTCTCTCTCTCCTTATCCAATGCTGCTCTAACCACCACTCCCAAAGTTAGCGCCAGG
TATCAATTATCGGTCGATTACTATGCTAAGAAATGCCCACAGCTTGATCAACTCGTAGCTTCCGTTACTTCACAGCAGTTCCAAGAAGCCCCAATTTCCGGGCCCGCCACTATTCGACTC
TTCTTCCACGACTGCTTCGTCGAA
GTAAAAAAAAAATGTTTTTTTTTCTTAATCATATCTCCTCTCCAAGTTTTTTTTTTTTTTTTTAAGTATTGATGTGTTGTTCTTGTATTTGATTTA
ATTATAAAAAAAGGGGTGTGATGCATCGATATTGATTTCGTCGAAACCCGGAAATAAAGAATTAGCTGAAAGAGATGCAGAGGAAAACAAGGATATGGCACCAGATGCTTATGACAGCAT
AAACAAGGCTAAGTCATTGGTTGAGAGCAAGTGCCCTGGAGTTGTGTCCTGTGCCGACATTCTTGCCATTGCAGCCAGAGATTTTGTCCATTTG
GTTANNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTGTTTGTTTGTATTTGAGGTTGATACAACTGGCTAATTAACATTAAGTTATTGTCAGAAATCACGA
GATTGATTCATAATCATTAGGGATTGTGAATTTGTGATTAATAAGATGAATCCAACAAAAGTCTTTTGTTTTTCTGATTGTCTCTATTTTTCAACTGCAGATAGGGACAGAGAGTGATCA
TCAACACTTTATTTCATTAAACATGACTTAATTTAATTACTCGTGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCAAGGCTGGAGGTCCATATTATCAAGTGAAGAAAGGGAG
ATGGGACGGAAAACTTTCGATGGCGTCTCGAGTTCAATCCAATCTTCCACGATCAAACTCAACCGTAGACGAACTTATCAAGCTCTTCAAGTCGAAAGGGTTAACAATCGAAGACCTAGT
TATCCTATCCGGGGCCCACACCATAGGTTTCGCGCACTGCAAGCACTTTGTGAGCCGGTTATACGACTACAAAGGCACGAAGCAACCCGATCCTTCGGTCGATCCAAGACTGCTCAAGGC
ACTCAAAATGTCGTGCCCGAACTACGGAGGGAATACGGATATCGTGGCGCCGTTTGATGTGACGACTCCGTTCTCGTTCGACAACGCTTATTACGGGAATTTGGAGGCTAAAATGGGATT
ACTTGCCTCTGATCAAGCACTGTTTGTTGATCCTAGGACTAATGGTTTGGTTCAGACAATGGCTAAGGATAAGCAGAAGTTCTTTCAGGCGTTTGCTTTGGCTATGGAGAAAATGGGGTC
TATTGGTGTTAAGAGAGGGAGAAGGCATGGGGAGAAAAGAAAAGATTGTAGTGTTCATATGGGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTATTTCTCCTCTCCTCCTCCTCCAATTCTCACATTCTTCATCTTTCTTCTCTCACTACTCTCTCTCTCCTTATCCAATGCTGCTCTAACCACCACTCCCAAAGTTAGCGCCAGG
TATCAATTATCGGTCGATTACTATGCTAAGAAATGCCCACAGCTTGATCAACTCGTAGCTTCCGTTACTTCACAGCAGTTCCAAGAAGCCCCAATTTCCGGGCCCGCCACTATTCGACTC
TTCTTCCACGACTGCTTCGTCGAA
GGGTGTGATGCATCGATATTGATTTCGTCGAAACCCGGAAATAAAGAATTAGCTGAAAGAGATGCAGAGGAAAACAAGGATATGGCACCAGATGCT
TATGACAGCATAAACAAGGCTAAGTCATTGGTTGAGAGCAAGTGCCCTGGAGTTGTGTCCTGTGCCGACATTCTTGCCATTGCAGCCAGAGATTTTGTCCATTTG
GCTGGAGGTCCATAT
TATCAAGTGAAGAAAGGGAGATGGGACGGAAAACTTTCGATGGCGTCTCGAGTTCAATCCAATCTTCCACGATCAAACTCAACCGTAGACGAACTTATCAAGCTCTTCAAGTCGAAAGGG
TTAACAATCGAAGACCTAGTTATCCTATCCGGGGCCCACACCATAGGTTTCGCGCACTGCAAGCACTTTGTGAGCCGGTTATACGACTACAAAGGCACGAAGCAACCCGATCCTTCGGTC
GATCCAAGACTGCTCAAGGCACTCAAAATGTCGTGCCCGAACTACGGAGGGAATACGGATATCGTGGCGCCGTTTGATGTGACGACTCCGTTCTCGTTCGACAACGCTTATTACGGGAAT
TTGGAGGCTAAAATGGGATTACTTGCCTCTGATCAAGCACTGTTTGTTGATCCTAGGACTAATGGTTTGGTTCAGACAATGGCTAAGGATAAGCAGAAGTTCTTTCAGGCGTTTGCTTTG
GCTATGGAGAAAATGGGGTCTATTGGTGTTAAGAGAGGGAGAAGGCATGGGGAGAAAAGAAAAGATTGTAGTGTTCATATGGGA

Retrieve as FASTA