Entry information : MguPrx15 (mgv1a009418m)
Entry ID 9185
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx15 (mgv1a009418m)
Name (synonym) MguPrx15 (mgv1a009418m)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx15
start..stop
S start..stop
NtPrx05-1A 529 0 1..342 1..329
CroPrx08 522 0 1..342 1..337
BrPrx09-1Aa_other 513 0 1..342 1..347
ThasPrx40 508 0 1..342 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156766..157023 258 N° 2 157114..157305 192 N° 3 157400..157565 166 N° 4 157742..158154 413
join(156766..157023,157114..157305,157400..157565,157742..158154)


exon

Literature and cross-references MguPrx15 (mgv1a009418m)
DNA ref. Phytozome 11:   scaffold_258 (156766..158154)
Protein sequence: MguPrx15 (mgv1a009418m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (319)
PWM (Da):   %s   37350.74 (34897.5)  
PI (pH):   %s   7.4 (7.47) Peptide Signal:   %s   cut: 24 range:24-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLKVLCSLVAAVLFCCSLSEAFPGSGYGSGYGGPYSGHLVPEYYRFSCPQANEIIMSVLENAIARDSRMAASLLRLHFHDCFVQGCDASVLLDDSANIASEKNSGPNKNSLRGFEVIDEIKAKIEQVCPHTVSCSDILALAARDSIVLSGGPHWEVPLGRRDSKTASLSKSNTDIPAPNSTIQTLINQFSKHGLDEQDLVALSGGHTIGVARCVTFRQRLYNQNGNNQPDVTLERNYYNGLKTVCPKSGGDNNISPLDFSSPVKFDNRYFKLILWGKGLLNSDEVLATGSVRKTLELVRSYAENEELFFHQFASSMVKMGNISPLVGLQGEIRKNCRRLN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTCAAAGTCCTTTGCAGCCTCGTTGCGGCGGTTCTCTTCTGTTGCTCTCTATCCGAAGCTTTTCCGGGTTCGGGCTACGGGTCGGGTTACGGCGGCCCGTATTCGGGCCAC
CTTGTACCCGAATACTACCGGTTTTCATGCCCACAAGCAAATGAGATCATAATGTCTGTACTGGAAAATGCTATTGCCAGAGATTCAAGAATGGCTGCTTCTTTGCTCAGGCTCCACTTT
CATGATTGCTTTGTCCAG
GTACATTCTTGAAAAAAAAATACTAGGGATTATTTTTTTTTAATGATGTAACAATTTTTTTTTTGTGACATTCTATATATGAATATATAGGGCTGCGACGCT
TCGGTTTTGCTTGACGACAGTGCGAATATAGCGAGCGAGAAAAATTCAGGGCCGAACAAGAATTCGCTTAGGGGATTCGAAGTGATAGACGAGATCAAAGCGAAAATCGAACAAGTGTGC
CCACACACTGTTTCTTGTTCAGACATTCTTGCTCTTGCTGCAAGAGATTCTATTGTCCTA
GTAAGTTAGTTACATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAATTAATT
AACGATTTTTGCGCGCGCACACACACACATTCAGAGTGGTGGGCCCCATTGGGAAGTGCCATTAGGGAGAAGGGACTCAAAAACAGCAAGCCTAAGCAAATCAAACACTGATATTCCAGC
TCCTAATTCCACAATTCAGACACTTATCAATCAATTCAGTAAACATGGTCTTGATGAACAAGATCTTGTTGCACTTTCTG
GNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNGGACCTTCTTGAATATTTATCCAGTCAGCAATTCGGAAAAAAATTGTTGCAATCTTTTTTTAATTGCGAAAAATGTCACGTTTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNGCAAAATTAGGGGGGCATACAATTGGAGTGGCAAGATGTGTGACATTCAGACAAAGATTGTACAACCAAAACGGCAACAACCAGCCCGACGTGACATTGGAGCGAAATTACTAC
AACGGCCTTAAAACCGTTTGCCCTAAAAGCGGGGGCGATAATAATATTTCGCCTCTGGATTTTTCATCTCCGGTGAAATTCGACAACAGGTACTTTAAGTTGATATTATGGGGCAAAGGG
CTTCTTAATTCGGACGAGGTTTTGGCGACGGGGAGTGTGAGGAAGACGTTGGAGCTCGTTCGAAGCTACGCGGAAAACGAGGAGCTTTTCTTTCACCAATTTGCTAGTTCAATGGTGAAG
ATGGGGAATATTAGTCCTCTTGTTGGTTTGCAAGGGGAGATTAGGAAAAATTGTCGTAGGTTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTCAAAGTCCTTTGCAGCCTCGTTGCGGCGGTTCTCTTCTGTTGCTCTCTATCCGAAGCTTTTCCGGGTTCGGGCTACGGGTCGGGTTACGGCGGCCCGTATTCGGGCCAC
CTTGTACCCGAATACTACCGGTTTTCATGCCCACAAGCAAATGAGATCATAATGTCTGTACTGGAAAATGCTATTGCCAGAGATTCAAGAATGGCTGCTTCTTTGCTCAGGCTCCACTTT
CATGATTGCTTTGTCCAG
GGCTGCGACGCTTCGGTTTTGCTTGACGACAGTGCGAATATAGCGAGCGAGAAAAATTCAGGGCCGAACAAGAATTCGCTTAGGGGATTCGAAGTGATAGAC
GAGATCAAAGCGAAAATCGAACAAGTGTGCCCACACACTGTTTCTTGTTCAGACATTCTTGCTCTTGCTGCAAGAGATTCTATTGTCCTA
AGTGGTGGGCCCCATTGGGAAGTGCCATTA
GGGAGAAGGGACTCAAAAACAGCAAGCCTAAGCAAATCAAACACTGATATTCCAGCTCCTAATTCCACAATTCAGACACTTATCAATCAATTCAGTAAACATGGTCTTGATGAACAAGAT
CTTGTTGCACTTTCTG
GGGGGCATACAATTGGAGTGGCAAGATGTGTGACATTCAGACAAAGATTGTACAACCAAAACGGCAACAACCAGCCCGACGTGACATTGGAGCGAAATTACTAC
AACGGCCTTAAAACCGTTTGCCCTAAAAGCGGGGGCGATAATAATATTTCGCCTCTGGATTTTTCATCTCCGGTGAAATTCGACAACAGGTACTTTAAGTTGATATTATGGGGCAAAGGG
CTTCTTAATTCGGACGAGGTTTTGGCGACGGGGAGTGTGAGGAAGACGTTGGAGCTCGTTCGAAGCTACGCGGAAAACGAGGAGCTTTTCTTTCACCAATTTGCTAGTTCAATGGTGAAG
ATGGGGAATATTAGTCCTCTTGTTGGTTTGCAAGGGGAGATTAGGAAAAATTGTCGTAGGTTGAATTAA

Retrieve as FASTA