Entry information : MguPrx16 (mgv1a009564m)
Entry ID 9186
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx16 (mgv1a009564m)
Name (synonym) MguPrx16 (mgv1a009564m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx16
start..stop
S start..stop
SinPrx01 523 0 6..338 1..330
HaPrx36 488 1e-175 6..338 1..327
LvPrx15 483 2e-173 6..338 1..328
MguPrx103 481 2e-172 32..338 17..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 141187..141426 240 N° 2 140836..141036 201 N° 3 140592..140750 159 N° 4 139762..140178 417
complement(join(139762..140178,140592..140750,140836..141036,141187..141426))


exon

Literature and cross-references MguPrx16 (mgv1a009564m)
DNA ref. Phytozome 12:   scaffold_336 (141426..139762)
Protein sequence: MguPrx16 (mgv1a009564m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (305)
PWM (Da):   %s   36414.44 (32901.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.57 (8.21) Peptide Signal:   %s   cut: 34 range:34-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRKTDMGRVNSLTSLILSLSVSIILFSGHPTSAELRQNFYSNICPDVENIVRSAVSRKASQTSITIPGTLRLFFHDCFVSGCDASVIVASTERNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPRCKNKVSCADILALAARDVIVLAGGPTYPVELGRLDGLSSTSASVNGNLPQPNFNLNQLNSMFASRGLTQADMIxLTGAHTLGFTHCSRITNRIYNFSSANPVDPTLNKQYASQLQATCRRNESDPRISVNLDPTTPGIFDNAYFENLIQGKGIFTSDQVLFTDSRSRNIVTNWASDSRAFNDAFIRAITKLGRVGVKTQGNGNIRFDCAKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAAACCGATATGGGCCGAGTTAATTCTCTTACAAGTCTAATATTATCACTTTCCGTGAGTATTATTCTGTTTTCCGGCCACCCTACGTCGGCGGAGCTCCGGCAGAACTTCTAT
TCAAACATATGCCCCGACGTCGAAAACATCGTAAGAAGCGCCGTTTCAAGAAAAGCCAGCCAAACGTCAATTACCATCCCGGGCACGCTTCGGCTCTTTTTCCATGACTGTTTTGTTTCG
GTACGTACTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTACAATTAATTAATCACGGTCATAATTAATTACTTGTACCTTGTGCTGTCTGATTTGTACATAAATTAAAT
GTGTGTTTCTGCGTGTGTTTTTTTTTGTAGGGGTGTGATGCGTCGGTGATAGTGGCATCGACGGAGCGGAACACGGCGGAGAAGGACCACCCGGACAATTTGTCACTCGCCGGAGATGGG
TTCGACACGGTGATCAAAGCCAAAGCCGCCGTGGATGCCGTCCCACGTTGTAAGAACAAGGTTTCTTGTGCTGATATTCTTGCATTGGCTGCTCGTGACGTCATTGTCCTG
GTTTGTACT
TTCTCTCTCTACACTCTCTCTCTCTCTCTAGAAGTTGTGAATTAACATGGTGGTGGTGTATGTGGTGGTGGAGCAGGCTGGTGGGCCCACGTATCCGGTGGAATTGGGGAGATTGGATGG
GTTGAGCTCCACGTCAGCAAGTGTGAATGGGAATCTGCCTCAGCCGAATTTCAATTTAAATCAGCTTAATTCCATGTTTGCTTCTAGAGGTTTAACACAAGCTGATATGATTGNN
NNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTGTGTGAAATAAAGTCACA
TGTGAAATGACTCTAAGATGTGTTATTCTAAATTTTTATATATTACATCATATATTAAACTATTTTCACAATTACACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCCC
TCGAAAATAAATAATTACAATTGTTGAGTGACAAAAGATTTCAAATTTCTTACAGGTGCACACACTCTAGGATTCACACACTGCAGCCGAATCACAAACCGGATCTACAATTTCAGCTCC
GCGAACCCGGTCGACCCGACCCTAAACAAGCAATACGCGAGCCAATTACAGGCTACGTGCCGGAGAAACGAATCGGATCCGAGAATATCCGTCAACTTGGATCCAACAACTCCTGGAATA
TTCGACAATGCCTACTTCGAGAATCTTATCCAAGGGAAGGGAATCTTCACTTCGGATCAAGTTTTATTCACGGATTCAAGATCGAGAAATATTGTTACTAATTGGGCTTCGGATTCTCGG
GCTTTTAATGATGCTTTTATTCGGGCTATTACTAAACTGGGTCGGGTCGGAGTCAAGACCCAAGGAAACGGGAATATCCGTTTTGATTGTGCAAAGTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAAACCGATATGGGCCGAGTTAATTCTCTTACAAGTCTAATATTATCACTTTCCGTGAGTATTATTCTGTTTTCCGGCCACCCTACGTCGGCGGAGCTCCGGCAGAACTTCTAT
TCAAACATATGCCCCGACGTCGAAAACATCGTAAGAAGCGCCGTTTCAAGAAAAGCCAGCCAAACGTCAATTACCATCCCGGGCACGCTTCGGCTCTTTTTCCATGACTGTTTTGTTTCG
GGGTGTGATGCGTCGGTGATAGTGGCATCGACGGAGCGGAACACGGCGGAGAAGGACCACCCGGACAATTTGTCACTCGCCGGAGATGGGTTCGACACGGTGATCAAAGCCAAAGCCGCC
GTGGATGCCGTCCCACGTTGTAAGAACAAGGTTTCTTGTGCTGATATTCTTGCATTGGCTGCTCGTGACGTCATTGTCCTG
GCTGGTGGGCCCACGTATCCGGTGGAATTGGGGAGATTG
GATGGGTTGAGCTCCACGTCAGCAAGTGTGAATGGGAATCTGCCTCAGCCGAATTTCAATTTAAATCAGCTTAATTCCATGTTTGCTTCTAGAGGTTTAACACAAGCTGATATGATTGNN
CTTACAGGTGCACACACTCTAGGATTCACACACTGCAGCCGAATCACAAACCGGATCTACAATTTCAGCTCCGCGAACCCGGTCGACCCGACCCTAAACAAGCAATACGCGAGCCAATTA
CAGGCTACGTGCCGGAGAAACGAATCGGATCCGAGAATATCCGTCAACTTGGATCCAACAACTCCTGGAATATTCGACAATGCCTACTTCGAGAATCTTATCCAAGGGAAGGGAATCTTC
ACTTCGGATCAAGTTTTATTCACGGATTCAAGATCGAGAAATATTGTTACTAATTGGGCTTCGGATTCTCGGGCTTTTAATGATGCTTTTATTCGGGCTATTACTAAACTGGGTCGGGTC
GGAGTCAAGACCCAAGGAAACGGGAATATCCGTTTTGATTGTGCAAAGTTTAATTGA

Retrieve as FASTA