Entry information : MguPrx19 (mgv1a009704m)
Entry ID 9189
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx19 (mgv1a009704m)
Name (synonym) MguPrx19 (mgv1a009704m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx19
start..stop
S start..stop
SaPrx39 392 1e-137 7..333 5..326
PpePrx21 370 6e-129 26..334 19..324
CagraPrx54 353 4e-122 12..334 16..341
AhalPrx23 349 1e-120 12..334 16..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93210..93437 228 N° 2 93715..94081 367 N° 3 94170..94579 410  
join(93210..93437,93715..94081,94170..94579)


exon

Literature and cross-references MguPrx19 (mgv1a009704m)
DNA ref. Phytozome 12:   scaffold_335 (93210..94579)
Protein sequence: MguPrx19 (mgv1a009704m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (308)
PWM (Da):   %s   35682.31 (33013.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.94 (7.72) Peptide Signal:   %s   cut: 27 range:27-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRVGVIVGVVFVVVVVLGCLKNGEAVGVGLSDNFYEESCPEVESIVRAGVQSASLTDPTTPAALLRLMFHDCQVQGCDASILVNPDGVITKSSEMGSTKNFGIRKRELISLVKSAVEAVCPRRVSCADILVMAAHEAVAFSGGPRIIRLPLGRRDSINPPNAGLADASLPHADIGLDSTLQLFAKKGMTIEESVAILGAHTLGVTHCINLQSRLYSTQKSNATNQNPAFELSLKTRCPQLAGPTASKISFMQNDLTSVIFDNEYFVNLMRGRGLLNIDSDMAVDSRTRQFVEKFAEDQGAFFRAFSSAFVKLSSYGVLTGNRGVVRRSCGALD

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGGGTTGGAGTAATAGTGGGAGTTGTATTTGTGGTGGTGGTGGTTTTGGGTTGTTTGAAGAATGGGGAAGCAGTAGGGGTAGGATTGTCCGATAATTTTTACGAGGAATCATGT
CCGGAAGTCGAGAGTATTGTCCGAGCAGGAGTTCAATCTGCCTCACTCACTGATCCTACCACCCCTGCTGCTCTCCTCCGCCTCATGTTTCATGACTGCCAAGTTCAG
GTNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNACACACACACACATATGACACGTGTCTCTGTGTGTCTTTGTGTGGGGGAGTGTTGCATGTTGTGGTAGAATGTAGAAATGTGGATATTCTTACTATTTAG
TGTCATAGTGTGTGTAATTTAAGAATGTAAAATGTGGATGTCACATGCACACAAACACATTTTAGTGCGTGTAATTTTCTTGATTTCGTGCAGGAAGTGTATATATAGATATGTTATTGT
GCATCTGATTTTCATTAATTGACAGGGCTGTGATGCTTCAATCCTAGTTAACCCAGACGGTGTGATAACGAAATCATCCGAGATGGGATCGACAAAGAATTTCGGTATTCGAAAGAGGGA
ATTGATAAGCCTTGTGAAATCAGCAGTCGAAGCAGTTTGCCCCAGACGGGTTTCGTGTGCAGACATTCTTGTAATGGCCGCTCATGAAGCAGTTGCCTTTTCCGGTGGTCCAAGAATTAT
TCGTCTCCCTTTAGGCCGAAGGGATTCTATCAATCCTCCAAACGCTGGATTAGCCGATGCTTCGCTCCCTCATGCGGATATCGGTCTTGATAGCACGCTTCAACTCTTTGCGAAAAAGGG
CATGACTATCGAAGAATCCGTCGCCATTTTAG
GTAATGAAATAAAAAAATTACAAAATCGTAGTTCTAATTAGCCGACAATTAATCGCCGATTTTGTTTTCTTTTTAAATGTCATTTCAG

GTGCACATACACTTGGAGTCACACATTGCATCAATCTCCAGAGCCGTCTGTACAGTACCCAAAAAAGCAACGCAACAAATCAAAATCCAGCATTCGAATTATCACTAAAAACGAGGTGCC
CTCAACTAGCGGGCCCCACAGCTTCAAAAATCAGTTTCATGCAGAACGACCTCACCTCAGTAATCTTCGACAACGAGTACTTTGTGAACTTGATGAGAGGCCGTGGATTGCTGAACATTG
ATTCCGACATGGCTGTCGATTCAAGAACAAGACAGTTTGTGGAGAAATTTGCCGAAGATCAGGGTGCGTTTTTTCGTGCTTTTTCTTCGGCTTTTGTGAAGCTCTCTTCTTACGGTGTTC
TTACAGGGAATCGGGGTGTTGTAAGGAGGAGTTGTGGTGCTTTGGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGGGTTGGAGTAATAGTGGGAGTTGTATTTGTGGTGGTGGTGGTTTTGGGTTGTTTGAAGAATGGGGAAGCAGTAGGGGTAGGATTGTCCGATAATTTTTACGAGGAATCATGT
CCGGAAGTCGAGAGTATTGTCCGAGCAGGAGTTCAATCTGCCTCACTCACTGATCCTACCACCCCTGCTGCTCTCCTCCGCCTCATGTTTCATGACTGCCAAGTTCAG
GGCTGTGATGCT
TCAATCCTAGTTAACCCAGACGGTGTGATAACGAAATCATCCGAGATGGGATCGACAAAGAATTTCGGTATTCGAAAGAGGGAATTGATAAGCCTTGTGAAATCAGCAGTCGAAGCAGTT
TGCCCCAGACGGGTTTCGTGTGCAGACATTCTTGTAATGGCCGCTCATGAAGCAGTTGCCTTTTCCGGTGGTCCAAGAATTATTCGTCTCCCTTTAGGCCGAAGGGATTCTATCAATCCT
CCAAACGCTGGATTAGCCGATGCTTCGCTCCCTCATGCGGATATCGGTCTTGATAGCACGCTTCAACTCTTTGCGAAAAAGGGCATGACTATCGAAGAATCCGTCGCCATTTTAG
GTGCA
CATACACTTGGAGTCACACATTGCATCAATCTCCAGAGCCGTCTGTACAGTACCCAAAAAAGCAACGCAACAAATCAAAATCCAGCATTCGAATTATCACTAAAAACGAGGTGCCCTCAA
CTAGCGGGCCCCACAGCTTCAAAAATCAGTTTCATGCAGAACGACCTCACCTCAGTAATCTTCGACAACGAGTACTTTGTGAACTTGATGAGAGGCCGTGGATTGCTGAACATTGATTCC
GACATGGCTGTCGATTCAAGAACAAGACAGTTTGTGGAGAAATTTGCCGAAGATCAGGGTGCGTTTTTTCGTGCTTTTTCTTCGGCTTTTGTGAAGCTCTCTTCTTACGGTGTTCTTACA
GGGAATCGGGGTGTTGTAAGGAGGAGTTGTGGTGCTTTGGATTGA

Retrieve as FASTA