Entry information : MguPrx21 (mgv1a009721m)
Entry ID 9191
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx21 (mgv1a009721m)
Name (synonym) MguPrx21 (mgv1a009721m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx21
start..stop
S start..stop
MguPrx23 667 0 1..333 1..333
VvPrx27 447 2e-159 27..333 25..332
AcoPrx60 444 4e-158 19..333 6..323
VvPrx28 442 3e-157 27..333 26..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 100420..100653 234 N° 2 99334..100101 768  
complement(join(99334..100101,100420..100653))


exon

Literature and cross-references MguPrx21 (mgv1a009721m)
DNA ref. Phytozome 11:   scaffold_16 (100653..99334)
Protein sequence: MguPrx21 (mgv1a009721m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (308)
PWM (Da):   %s   35823.62 (33026.1) Transmb domain:   %s   i7-25o
PI (pH):   %s   9.71 (9.49) Peptide Signal:   %s   cut: 26 range:26-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMKHSKFAVALVLLLSLQILSSAMAKSKSPQKLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAGKPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYDVPSGRRDGRVSLSSEVLANLPPPFFSAAQLKENFKRKGLSLDEMVTLSGAHSIGVSHCSAFSTRLSGFNATFDKDPSLDSGYAAFLKTKCPVPAKGDPAVNNDFQTPTVLDNKYYVNLKNHKGLLTSDQTLFDSSLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIDVLTGKQGEIRKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGCACTCCAAGTTTGCAGTAGCACTTGTGTTGCTGTTGAGCCTCCAGATTTTGAGCAGCGCCATGGCTAAATCTAAATCACCTCAGAAACTCAAGGTCGGATTTTACGCATAT
AAATGCCCACACGCCGAAATCATTGTCCGCAAAGCAGTCAACAAAGCCGTGTCACTCAATCCCGGTTTAGCTGCCGGCATAATCAGGCTGCATTTCCACGACTGCTTCGTCAGG
GTATGT
ATACGCACTATTTCTTCGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNTAGTATTTTTTATATAAACTTATGCAACATTGATTTGAAGNNNNNNNNNNNNNNNNNNNNNNNNCCAGGGCTGTGACGGTTCGCTGCTGTTGGACACCGTGGCTGGAAAGCCAGCG
GCGGAGAAAGAAAACGTGGCAAATTTCCCAAGCCTACGTGGCTTTGAGGTAATCGACCAAGCCAAAGCCGATATCGAAGCTGTCTGCCCCGGAACCGTTTCATGTGCAGACATTCTAGCA
TTCGCCGCTCGAGACAGCTCACTCAAAGCCGGATACATCGGCTACGATGTTCCCTCTGGGCGAAGAGACGGCCGTGTTTCTCTCAGTTCAGAAGTGCTCGCAAACCTACCACCACCGTTC
TTCTCCGCCGCCCAACTAAAGGAAAACTTCAAGAGAAAGGGGCTCTCGCTCGACGAGATGGTCACACTTTCCGGCGCACACTCCATCGGTGTTTCTCACTGCTCTGCCTTTTCCACCAGG
CTCTCTGGGTTCAACGCCACCTTCGATAAAGACCCTTCTTTGGACTCTGGTTATGCTGCTTTCCTTAAAACTAAGTGCCCAGTTCCGGCGAAAGGCGATCCTGCGGTGAACAATGATTTT
CAGACGCCGACTGTGCTGGACAACAAGTACTATGTTAACTTGAAGAATCACAAGGGGCTTCTAACCTCCGACCAGACACTTTTCGACAGTTCCCTGACGAAGAATCTGGTGTTGAACAAT
GTTAAGTACGGGTCTGTTTGGGCTAAAAAGTTTGCTGCTGCGATGGTGCATATGGGTTCCATTGATGTGCTCACCGGGAAACAGGGCGAGATCAGGAAAAACTGCCGTTTGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGCACTCCAAGTTTGCAGTAGCACTTGTGTTGCTGTTGAGCCTCCAGATTTTGAGCAGCGCCATGGCTAAATCTAAATCACCTCAGAAACTCAAGGTCGGATTTTACGCATAT
AAATGCCCACACGCCGAAATCATTGTCCGCAAAGCAGTCAACAAAGCCGTGTCACTCAATCCCGGTTTAGCTGCCGGCATAATCAGGCTGCATTTCCACGACTGCTTCGTCAGG
GGCTGT
GACGGTTCGCTGCTGTTGGACACCGTGGCTGGAAAGCCAGCGGCGGAGAAAGAAAACGTGGCAAATTTCCCAAGCCTACGTGGCTTTGAGGTAATCGACCAAGCCAAAGCCGATATCGAA
GCTGTCTGCCCCGGAACCGTTTCATGTGCAGACATTCTAGCATTCGCCGCTCGAGACAGCTCACTCAAAGCCGGATACATCGGCTACGATGTTCCCTCTGGGCGAAGAGACGGCCGTGTT
TCTCTCAGTTCAGAAGTGCTCGCAAACCTACCACCACCGTTCTTCTCCGCCGCCCAACTAAAGGAAAACTTCAAGAGAAAGGGGCTCTCGCTCGACGAGATGGTCACACTTTCCGGCGCA
CACTCCATCGGTGTTTCTCACTGCTCTGCCTTTTCCACCAGGCTCTCTGGGTTCAACGCCACCTTCGATAAAGACCCTTCTTTGGACTCTGGTTATGCTGCTTTCCTTAAAACTAAGTGC
CCAGTTCCGGCGAAAGGCGATCCTGCGGTGAACAATGATTTTCAGACGCCGACTGTGCTGGACAACAAGTACTATGTTAACTTGAAGAATCACAAGGGGCTTCTAACCTCCGACCAGACA
CTTTTCGACAGTTCCCTGACGAAGAATCTGGTGTTGAACAATGTTAAGTACGGGTCTGTTTGGGCTAAAAAGTTTGCTGCTGCGATGGTGCATATGGGTTCCATTGATGTGCTCACCGGG
AAACAGGGCGAGATCAGGAAAAACTGCCGTTTGGTTAATTAA

Retrieve as FASTA