Entry information : MguPrx22 (mgv1a009726m)
Entry ID 9192
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx22 (mgv1a009726m)
Name (synonym) MguPrx22 (mgv1a009726m)
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx22
start..stop
S start..stop
MguPrx108 679 0 1..333 1..333
MguPrx02 563 0 15..333 8..325
MguPrx27 511 0 4..333 1..331
MguPrx29 510 0 7..333 3..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94278..94517 240 N° 2 93406..94167 762  
complement(join(93406..94167,94278..94517))


exon

Literature and cross-references MguPrx22 (mgv1a009726m)
DNA ref. Phytozome 12:   scaffold_16 (94517..93406)
Protein sequence: MguPrx22 (mgv1a009726m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (307)
PWM (Da):   %s   36039.65 (33241.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.48 (8.56) Peptide Signal:   %s   cut: 27 range:27-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALTNSHAVVIIGLLLSCFILFVSAADDNSTAALTVGFYKNSCPFAEIIVRKYVNKFVTFNPGFAAGLIRLHFHDCFVRGCDASVLLDGKNSEKQSIPNKGSLRGFEIIDAAKAELEVKCPGIVSCADILAFSARDSAWKAGNIFYEVPAGRRDGNVSNTLDPLLNLPPPFFNATQLRDNFARKGLTLDEMVTLSGAHSIGIAHCTSFLGRLYPTVDPTLDPKYAAKLKKICPAPVANATGPPKVNPTVNQDTITPIRLDNLYYLGLKQKKGLFTSDQDLMTSPLTSNIVLNNIQFGGVWATKFAAAMVKMGNIDVLTGVQGEVREHCRHIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCCTAACAAATTCCCATGCAGTCGTCATAATTGGGTTGCTTCTCTCTTGCTTCATATTGTTTGTTTCAGCCGCTGATGATAATTCAACCGCAGCCCTCACAGTTGGCTTCTAC
AAAAACTCCTGTCCCTTTGCAGAAATCATTGTCCGAAAATACGTCAACAAATTCGTCACTTTCAACCCTGGTTTTGCTGCTGGCCTTATCAGGCTGCACTTCCACGATTGCTTTGTCAGG
GTATGTATATATGTACATTCTCGTTAATTTTTTTTTAGATATTATATCAATCTTCTTTTCGTTTCCTAAATATATATATATCTGTGTGTTTTTAATTAATTTACCTATAGGGTTGTGATG
CTTCTGTGTTGTTGGATGGAAAAAACTCGGAAAAGCAAAGTATACCAAACAAGGGAAGCCTACGTGGGTTCGAAATAATAGACGCAGCAAAAGCAGAACTTGAGGTGAAATGCCCTGGAA
TTGTTTCATGTGCAGACATTCTCGCCTTCTCAGCCAGAGACAGCGCCTGGAAAGCTGGCAACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAATGTATCCAACACACTCGACC
CACTTCTAAATCTTCCCCCGCCCTTCTTCAACGCAACTCAACTCAGGGACAATTTTGCAAGAAAGGGTCTCACACTCGACGAAATGGTTACACTTTCAGGGGCTCACTCCATTGGAATTG
CTCATTGTACTTCCTTCTTAGGACGTCTATACCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAAAAAGATATGCCCTGCGCCTGTTGCTAATGCGACCGGTCCAC
CGAAAGTGAACCCCACAGTCAATCAGGATACCATCACTCCGATTCGTTTGGACAATTTATACTACTTGGGATTGAAGCAGAAGAAGGGGCTTTTTACGTCGGATCAGGATCTTATGACAA
GCCCTTTGACTTCCAATATTGTTCTCAACAATATTCAGTTTGGTGGTGTGTGGGCTACCAAGTTTGCTGCTGCCATGGTCAAAATGGGAAATATTGATGTACTCACCGGCGTCCAGGGCG
AGGTCAGGGAACACTGCCGCCACATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCCTAACAAATTCCCATGCAGTCGTCATAATTGGGTTGCTTCTCTCTTGCTTCATATTGTTTGTTTCAGCCGCTGATGATAATTCAACCGCAGCCCTCACAGTTGGCTTCTAC
AAAAACTCCTGTCCCTTTGCAGAAATCATTGTCCGAAAATACGTCAACAAATTCGTCACTTTCAACCCTGGTTTTGCTGCTGGCCTTATCAGGCTGCACTTCCACGATTGCTTTGTCAGG
GGTTGTGATGCTTCTGTGTTGTTGGATGGAAAAAACTCGGAAAAGCAAAGTATACCAAACAAGGGAAGCCTACGTGGGTTCGAAATAATAGACGCAGCAAAAGCAGAACTTGAGGTGAAA
TGCCCTGGAATTGTTTCATGTGCAGACATTCTCGCCTTCTCAGCCAGAGACAGCGCCTGGAAAGCTGGCAACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAATGTATCCAAC
ACACTCGACCCACTTCTAAATCTTCCCCCGCCCTTCTTCAACGCAACTCAACTCAGGGACAATTTTGCAAGAAAGGGTCTCACACTCGACGAAATGGTTACACTTTCAGGGGCTCACTCC
ATTGGAATTGCTCATTGTACTTCCTTCTTAGGACGTCTATACCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAAAAAGATATGCCCTGCGCCTGTTGCTAATGCG
ACCGGTCCACCGAAAGTGAACCCCACAGTCAATCAGGATACCATCACTCCGATTCGTTTGGACAATTTATACTACTTGGGATTGAAGCAGAAGAAGGGGCTTTTTACGTCGGATCAGGAT
CTTATGACAAGCCCTTTGACTTCCAATATTGTTCTCAACAATATTCAGTTTGGTGGTGTGTGGGCTACCAAGTTTGCTGCTGCCATGGTCAAAATGGGAAATATTGATGTACTCACCGGC
GTCCAGGGCGAGGTCAGGGAACACTGCCGCCACATCAACTGA

Retrieve as FASTA