Entry information : MguPrx23 (mgv1a009735m)
Entry ID 9193
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx23 (mgv1a009735m)
Name (synonym) MguPrx23 (mgv1a009735m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx23
start..stop
S start..stop
MguPrx21 637 0 1..333 1..333
VvPrx27 451 5e-161 27..333 25..332
StPrx22 449 1e-159 35..333 52..353
VvPrx28 446 9e-159 27..333 26..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 69282..69515 234 N° 2 69784..70551 768  
join(69282..69515,69784..70551)


exon

Literature and cross-references MguPrx23 (mgv1a009735m)
DNA ref. Phytozome 11:   scaffold_16 (69282..70551)
Protein sequence: MguPrx23 (mgv1a009735m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (308)
PWM (Da):   %s   35758.59 (33121.1) Transmb domain:   %s   i7-25o
PI (pH):   %s   9.49 (9.20) Peptide Signal:   %s   cut: 26 range:26-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMKHSKFAVALVVLLSLQILSSAVAKSKSPQKLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAGKPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYEVPSGRRDGRVSLSSEVLQNLPPPFFSAAELKENFKRKGLSLDEMVTLSGAHSIGVSHCSAFSNRLSGFNATFDKDPSLDSGYAAFLKTKCPVPANGDPAVNNDFQTPTVLDNKYYVNLKNHKGLLTSDQTLFDSPLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIEVLTGKQGEIRKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGCACTCCAAGTTTGCAGTAGCACTTGTGGTGCTGTTGAGCCTCCAGATTTTGAGCAGCGCCGTGGCTAAATCTAAATCACCCCAGAAACTCAAGGTCGGATTTTACGCATAT
AAATGCCCACACGCCGAAATCATTGTCCGCAAAGCCGTCAACAAAGCCGTGTCACTCAATCCCGGTTTAGCCGCCGGCATAATCAGGCTGCACTTCCACGACTGCTTCGTCAGG
GTATGT
ATTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGAATGCAACATTAATTTGATGNNNNNN
NNNNNNNNNNNNNNNNNNCCAGGGCTGTGACGGTTCGCTGTTGTTGGACACCGTGGCTGGGAAGCCAGCGGCCGAGAAAGAAAACGTGGCAAATTTCCCAAGCCTACGTGGCTTTGAGGT
AATCGACCAAGCCAAAGCCGATATCGAAGCTGTCTGCCCCGGCACCGTTTCATGTGCGGACATTCTAGCATTCGCCGCTCGAGACAGCTCACTCAAAGCCGGATACATCGGCTACGAAGT
CCCCTCTGGGCGAAGAGACGGCCGTGTTTCTCTCAGTTCAGAAGTGCTCCAAAACCTACCACCACCGTTCTTCTCGGCAGCCGAACTCAAGGAAAACTTCAAGAGAAAGGGGCTCTCGCT
CGACGAGATGGTCACACTTTCCGGCGCACACTCCATCGGTGTTTCTCACTGCTCCGCCTTTTCCAACAGGCTCTCTGGGTTCAACGCCACCTTCGATAAAGACCCTTCTTTGGACTCTGG
TTATGCTGCTTTTCTTAAAACTAAGTGCCCAGTTCCGGCGAACGGCGATCCTGCGGTGAACAATGATTTTCAGACTCCGACGGTGCTGGACAACAAGTACTATGTTAATTTGAAGAATCA
CAAGGGGCTTCTAACCTCGGACCAGACACTTTTCGACAGTCCGCTGACGAAGAATCTGGTGTTGAACAATGTTAAGTACGGGTCGGTTTGGGCTAAGAAGTTTGCTGCTGCAATGGTGCA
TATGGGTTCCATTGAAGTGCTCACTGGGAAACAGGGCGAGATCAGGAAAAACTGCCGTTTGGTTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGCACTCCAAGTTTGCAGTAGCACTTGTGGTGCTGTTGAGCCTCCAGATTTTGAGCAGCGCCGTGGCTAAATCTAAATCACCCCAGAAACTCAAGGTCGGATTTTACGCATAT
AAATGCCCACACGCCGAAATCATTGTCCGCAAAGCCGTCAACAAAGCCGTGTCACTCAATCCCGGTTTAGCCGCCGGCATAATCAGGCTGCACTTCCACGACTGCTTCGTCAGG
GGCTGT
GACGGTTCGCTGTTGTTGGACACCGTGGCTGGGAAGCCAGCGGCCGAGAAAGAAAACGTGGCAAATTTCCCAAGCCTACGTGGCTTTGAGGTAATCGACCAAGCCAAAGCCGATATCGAA
GCTGTCTGCCCCGGCACCGTTTCATGTGCGGACATTCTAGCATTCGCCGCTCGAGACAGCTCACTCAAAGCCGGATACATCGGCTACGAAGTCCCCTCTGGGCGAAGAGACGGCCGTGTT
TCTCTCAGTTCAGAAGTGCTCCAAAACCTACCACCACCGTTCTTCTCGGCAGCCGAACTCAAGGAAAACTTCAAGAGAAAGGGGCTCTCGCTCGACGAGATGGTCACACTTTCCGGCGCA
CACTCCATCGGTGTTTCTCACTGCTCCGCCTTTTCCAACAGGCTCTCTGGGTTCAACGCCACCTTCGATAAAGACCCTTCTTTGGACTCTGGTTATGCTGCTTTTCTTAAAACTAAGTGC
CCAGTTCCGGCGAACGGCGATCCTGCGGTGAACAATGATTTTCAGACTCCGACGGTGCTGGACAACAAGTACTATGTTAATTTGAAGAATCACAAGGGGCTTCTAACCTCGGACCAGACA
CTTTTCGACAGTCCGCTGACGAAGAATCTGGTGTTGAACAATGTTAAGTACGGGTCGGTTTGGGCTAAGAAGTTTGCTGCTGCAATGGTGCATATGGGTTCCATTGAAGTGCTCACTGGG
AAACAGGGCGAGATCAGGAAAAACTGCCGTTTGGTTAACTGA

Retrieve as FASTA