Entry information : MguPrx24 (mgv1a009759m)
Entry ID 9194
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx24 (mgv1a009759m)
Name (synonym) MguPrx24 (mgv1a009759m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx24
start..stop
S start..stop
CclPrx07 510 0 12..332 4..323
CsPrx15 510 0 12..332 4..323
GhPrx13 506 0 33..332 23..322
SaPrx34 505 0 19..330 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 888506..888751 246 N° 2 888883..889074 192 N° 3 889639..889807 169 N° 4 889998..890386 389
join(888506..888751,888883..889074,889639..889807,889998..890386)


exon

Literature and cross-references MguPrx24 (mgv1a009759m)
DNA ref. Phytozome 12:   scaffold_1 (888506..890386)
Protein sequence: MguPrx24 (mgv1a009759m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (297)
PWM (Da):   %s   35647.99 (32216.3) Transmb domain:   %s   i13-35o
PI (pH):   %s   8.88 (8.89) Peptide Signal:   %s   cut: 36 range:36-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSSSSSSSSYSSVFVIATLLIVLLMNVGPSSAQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDDTSSFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEWDVKVGRRDSKTASLAAANSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQARCSLFRTRIYNETNIDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKKKGLLHSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRKNCRRA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCTCCTCTTCTTCGTCTTCGTCCTCGTCTTATTCGTCGGTGTTTGTGATTGCGACTTTACTAATTGTCTTATTGATGAATGTGGGGCCCTCGTCGGCTCAACTGACAGAGGAT
TACTACAAGAAGACATGCCCGAAGGTGTTCGATACCGTCGAGTCCGCCGTTAAGTCCGCGATCAAAAAGGAGAAACGCATGGGCGCCTCCCTCATCCGACTGCACTTCCACGATTGTTTT
GTCCAA
GTACGTATTTTATATATATAACTAACTTCTCGTAATTTTCAAGCTTCATTAGATGCGCTAATCATTATTTTTCTTCTTCATTTTTTTAGTAATTATGTATTACCTTAATATGAT
TATTAAAATTTGGACAGGGGTGTGACGCGTCAGTACTACTGGACGACACATCATCGTTCACCGGCGAGAAGACTGCGGCCCCCAACAATAATTCGATAAGGGGTTTCAACGTTGTGGACG
ATATCAAGTCCAAGGTGGAGTCCGTGTGCCCCGGTGTCGTCTCATGCGCCGATATTCTAGCCATTGCCGCCCGCGATTCTGTCTCCATT
GTGAGTTTNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNTAAATTTTATAACTAGTACCGATATTTAATTATAATCATTGTAGCTAGTGCTCCATTTGTATGAAAGAATCTGAAGACGGGGGCCCACGCCCCCCGTCGC
CTCATCTTGGCTCCGCCACTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGCTCGGAGGGCCGGAATGGGATGTGAAAGTCGGAAGACGAGACTCGAAAACGGCGAGCCTTGCGGCTG
CAAATAGTGGTGTGATTCCACCACCAACTTCAACTCTTAACAACCTTGTCAATAGGTTCCAAGCTAGAGGACTCTCCACCAAGGACATGGTTGCATTATCAG
GTCCTCATATTTATATAT
ATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNCATTTTTGATTTTGTCTAAAAAAACAGGAGCACACACCATTGGGCAGGCGAGATGCAGCCTGTTCCGAACGCGTATATACAACGAGACGAACATA
GACGCTTCTTTCGCTCGTAAGAGACAAGATAACTGCCCCCGCACGACCGGGTCGGGCGACAATAACTTGGCCTCACTCGACGTCAAAAGCCCCACATTCTTCGACAACGCTTACTACAAA
AACCTAATCAAGAAGAAGGGGTTGTTGCACTCCGATCAGATTCTGTACAACGGTGGATCGACGGATTCGCTTATCGAAACGTACAGCAAGAAACCTGAGACGTTCAACGATGATTTCGTC
ACGGCTATGATCAAGATGGGTGACATCAGCCCCCTCACTGGATCCAATGGTGAGATCAGAAAGAATTGCAGGAGGGCCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCTCCTCTTCTTCGTCTTCGTCCTCGTCTTATTCGTCGGTGTTTGTGATTGCGACTTTACTAATTGTCTTATTGATGAATGTGGGGCCCTCGTCGGCTCAACTGACAGAGGAT
TACTACAAGAAGACATGCCCGAAGGTGTTCGATACCGTCGAGTCCGCCGTTAAGTCCGCGATCAAAAAGGAGAAACGCATGGGCGCCTCCCTCATCCGACTGCACTTCCACGATTGTTTT
GTCCAA
GGGTGTGACGCGTCAGTACTACTGGACGACACATCATCGTTCACCGGCGAGAAGACTGCGGCCCCCAACAATAATTCGATAAGGGGTTTCAACGTTGTGGACGATATCAAGTCC
AAGGTGGAGTCCGTGTGCCCCGGTGTCGTCTCATGCGCCGATATTCTAGCCATTGCCGCCCGCGATTCTGTCTCCATT
CTCGGAGGGCCGGAATGGGATGTGAAAGTCGGAAGACGAGAC
TCGAAAACGGCGAGCCTTGCGGCTGCAAATAGTGGTGTGATTCCACCACCAACTTCAACTCTTAACAACCTTGTCAATAGGTTCCAAGCTAGAGGACTCTCCACCAAGGACATGGTTGCA
TTATCAG
GAGCACACACCATTGGGCAGGCGAGATGCAGCCTGTTCCGAACGCGTATATACAACGAGACGAACATAGACGCTTCTTTCGCTCGTAAGAGACAAGATAACTGCCCCCGCACG
ACCGGGTCGGGCGACAATAACTTGGCCTCACTCGACGTCAAAAGCCCCACATTCTTCGACAACGCTTACTACAAAAACCTAATCAAGAAGAAGGGGTTGTTGCACTCCGATCAGATTCTG
TACAACGGTGGATCGACGGATTCGCTTATCGAAACGTACAGCAAGAAACCTGAGACGTTCAACGATGATTTCGTCACGGCTATGATCAAGATGGGTGACATCAGCCCCCTCACTGGATCC
AATGGTGAGATCAGAAAGAATTGCAGGAGGGCCAAT

Retrieve as FASTA