Entry information : MguPrx25 ( mgv1a009760m)
Entry ID 9195
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2014-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-03-31 (Christophe Dunand)
Peroxidase information: MguPrx25 ( mgv1a009760m)
Name (synonym) MguPrx25 ( mgv1a009760m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx25
start..stop
S start..stop
SaPrx19 520 0 16..319 28..331
LsaPrx06 514 0 1..332 4..331
CroPrx50 509 0 23..327 23..327
CpapPrx43 505 0 16..327 15..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 521531..521734 204 N° 2 521251..521442 192 N° 3 520060..520662 603  
complement(join(520060..520662,521251..521442,521531..521734))


exon

Literature and cross-references MguPrx25 ( mgv1a009760m)
DNA ref. Phytozome 12:   scaffold_58 (521731..520060)
Protein sequence: MguPrx25 ( mgv1a009760m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (315)
PWM (Da):   %s   36235.31 (34392.2)  
PI (pH):   %s   4.5 (4.45) Peptide Signal:   %s   cut: 18 range:18-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFIIALLSLLLRLTSAASPPSLRPGFYSESCPEAESVVREVLRQAMARETRSAASVMRLQFHDCLVNGCDGSLLLDDTAEMVGEKLALSNINSLRSYEVVDEIKEALEIVCPNVVSCADILIIAARDAVLLSGGPNWEVKLGRKDSLTASQEASNDIMPSPRANASSLITLFAKFNLTVKDLVALSGSHSIGKARCFSIVFRLYNQSGTGRPDPSIDPDYREKLDGLCPLGGDEEVTGDLDSTPEIFDNRYFKDLVNGRGFLNSDETLFTFDETRVYVKMFSESESEFFKAFVEGMIKLGDLQSGFPGEIRRSCRAVNGRPVEEVLVATKR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGTTTTTCG GTTTATCGAT TTTTTTGCTC ACTCCTTCAA TTGACTATTT CAATTGAAGG TAAGCAAAGC TAAGTTACTA AATACTCATA GGTAGGGTTG GGACTCCGTT AGTTTTTGTC  CCGCAAACGA TCTATTATCT ATCATATTTC TAGACAGATA ATATTTTTCT AGAAAAATGA TTGGGTCGGG TCGAAAATTT CAACCAACGC ATTTATAATG GGTCAGTTTA TGGTTTTTAA  TATCATCAAA AGTTATATGT CAACCATCTA ACTATATTAA TAAAATTTCA TTAAAATATT ATTTTAATTT CTAATTGTTT AAAAAAAAAT TCTAAATTAA GTGTGTAATT TTTGTAAGTG  GGCAGTAGAA TTATCAAAAT AGTTAGTATT TTAATTTAAA AAATCAACAA AGAAAACAAG TTGACACAAA TCTTCTACCA ATTACATTAT ACCTATGCCG CCCTTTGAAA ATAAGCTCAC  AAAAATTTCA CCAATTTCGG AATTGTACTT TTATCGAGTT GCTATTAATT ATTTGGGTAA ATTACAAACA CCCCCCTGAG GTATGACCAA ATTACAAAAA CACCCCTCTT GTTTGGATAA  TTACAACCAC CCCCCTCAAC TCATCAAATT TAGTGGAATC TTCGAGATTA TATGGAATAT TATCACTTTT GTACCCGTTT TATCCCATTC AAACTCTACA TTATGAAGCA AGATGACCAT  AATTTGTGAT TTTTAGTTTG TATATATCAG TTTGTGGTGC ATCGGAAACT GTATTTTTTA CACAAAGAGT ACAAACTAGA GCACATTTCA CGGAATCTAG ATGACTATGT TGAATTTGGC  ACCATAAAGG TAAGAAAAAA TCATAGTTGA GGGGGGTAGA TGTAATTATC CAAACAAGAA GGTTTTTTTT GTAATTTGAC CATACCTCAG GGGGGTGTTT GTAATTTACT CTAATTATTT  TGAAATGGCA TATTTTAACT CCAATTTTCG GAATTTTAAA GTGAATTAGA TGGCGATGCA TATTCGGCAA TTTCGGAACC AAATATTCAA TTGTCAACCA TCAACCGACC CACAAAAATA  GAACTATCGG TCTTAAATTG ATTTGCCCGA TAAATTGGTT TTTAGGTCGA TGATCCAACC CTCCATAAGA AAAATGTTTA ATTATCATTG AAAAAATCGA AATTGAAATT GCATCACCTT  TCCAGCATGC ACCCCTATCC AACCACAACA AACTCTCGTG TCAGAATTAG TTTCACAAAT TCCCACACAC TCACCCAATT GGCCCCATTT TTGCCTCACA TTATTACCAC AATCTAAAAA  TTAAATAATA ATAATTAATT AAAAAAAAAG GCATCCAATG AATTATCGAC ACATACGCAA AAGAATTATT CATCCTACAG AAAAACAAGG ATTTACAATC AACCCCTAAG GTATGCTCAA  AATACAAAAT AACCCCTCAT ATTTGGGTAA TTACAACCAC CACCTTAAAC AACCCCTCAT ATTTGAGTAA TTACAACCAT TACCCTCAAC GATAAATCTT CTTACACGTC TATCATTGCG  GTGTCAAATT TAGTGAAATC TTCTTGGTTA TATGGAATAT TCTCAATTTT GTACCCGTTG AGCTCCATAT TTTTAAGCAA TATGATCATA AGATGTGTGT CTCTTGGCAT GTAAAGATCA  GATTGTGGTC CATCATAAAC TGCATTTTTG CACAAAAAGA GTTAAAATTA GAGAACATTC CACATAATCT AGAAGATTAT ATTGAATTTG ACACCATAAA AGTGGACGTG TAAGAAGATT  TATAGTTGAT AGGGGTAGTT GTAAAATCAT CCAAACATGA AGGGTGTTTT CATAATTTGA TCATACTGGG GCAATTCTAA TTTAGCAAAA AAAAAAAAAA AAACAAATGT CCCAAATTTC 
CCCACAACTA CATAAAGAAA ACATCCAAAA AGCCCCATAC AACTCTCTTT CCTTTGTACC ATTTTCAGTG AAAGAAAACC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCATTATTGCTCTCCTCTCCCTCCTCCTCCGCCTCACCTCCGCCGCATCTCCGCCCTCCCTCCGGCCAGGTTTCTACTCGGAAAGCTGCCCGGAAGCGGAATCCGTCGTAAGG
GAAGTCCTCCGGCAAGCCATGGCCAGAGAAACAAGAAGCGCTGCCTCTGTCATGCGGTTGCAGTTCCATGATTGCTTAGTTAAT
GTAATAAAATATAAAATCAAGAACCCTTTATAAATA
TTTAATTGGAAATTATAATTTCTTGAATTATTATTATTAATTTTATTTATAGGGTTGTGATGGTTCGTTGTTGCTGGATGACACGGCGGAGATGGTGGGGGAGAAATTAGCATTGTCGAA
CATAAATTCGTTGAGATCATATGAAGTTGTCGACGAAATTAAGGAAGCTTTGGAGATTGTGTGTCCGAATGTTGTCTCTTGTGCTGATATTTTAATCATTGCTGCTAGAGATGCTGTTCT
TCTG
GTATGCCTTTTTTTTTTTTTTTTATCACCTTTTCCTTGTGATTTTTTTTAAATTTGGCACAAATTATATATTTGACAGATCTGAAATTAAAGATGGATTTGTGAAAACCATTATTA
CACTTGTAGCCCACATTGATTCTCTTGATTCAATTGTGACCGTAGATTTAAGTTCTTGTTCCACGAGGGTAAAAATGTCATTTATTATTTTCGAAATGGATTTTTAGTCGAAAGTACAAC
TTCAAGAAAAAAAAATATTAATTTTTGGGTGATTTTTTCAAATTCCATGGGTTTTTTGAAGCATAATCAGAAGACTAAAATCGTATTTTTATTTCAACGAGGGTAAAAAGGTCATTTACT
GATTCCAACATGGGTTTCAAGTCGAATTCAGGACGTATTTCTTATTCAACAAGGTTAAAAACGTCATTTACTAACTTCGAGTCGGTTCGTAGTGGAAACCACACCTCAAGAAAATTTCCG
TTAATTTTTCAAACTCGATCGAGTTTACGTGTAATTAGACCTAACCAGAGGACTATTCCGTACAGTGTAATTTACTAATTTACCCTTGTATCGTCGTTGATTTGAAAATTAGAGTGGAGG
ACCAAATTGGGAAGTGAAATTAGGGAGGAAAGACAGCCTAACAGCCAGCCAAGAAGCTTCAAACGACATAATGCCGAGCCCACGAGCCAATGCAAGTTCCTTAATTACCCTCTTCGCCAA
ATTCAACCTCACCGTCAAAGACTTGGTCGCCCTCTCCGGGTCCCACTCCATCGGAAAAGCAAGGTGCTTCTCCATAGTCTTCCGGCTCTACAACCAATCGGGCACGGGCCGGCCCGACCC
ATCGATCGACCCGGATTACCGCGAGAAGCTAGACGGGTTATGCCCGCTCGGCGGCGACGAAGAAGTCACCGGAGATCTAGATTCTACGCCGGAGATATTCGATAATCGGTATTTCAAGGA
CTTGGTTAATGGGAGGGGGTTTTTGAACTCGGACGAGACTTTGTTCACGTTTGATGAGACTAGGGTTTACGTGAAGATGTTTAGTGAGAGTGAGAGCGAGTTTTTCAAAGCGTTTGTTGA
GGGGATGATTAAGTTGGGGGATCTGCAGTCGGGGTTTCCCGGCGAGATTAGGAGGAGTTGTAGGGCGGTGAACGGGCGGCCGGTGGAGGAGGTGTTGGTGGCGACAAAGCGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCATTATTGCTCTCCTCTCCCTCCTCCTCCGCCTCACCTCCGCCGCATCTCCGCCCTCCCTCCGGCCAGGTTTCTACTCGGAAAGCTGCCCGGAAGCGGAATCCGTCGTAAGG
GAAGTCCTCCGGCAAGCCATGGCCAGAGAAACAAGAAGCGCTGCCTCTGTCATGCGGTTGCAGTTCCATGATTGCTTAGTTAAT
GGTTGTGATGGTTCGTTGTTGCTGGATGACACGGCG
GAGATGGTGGGGGAGAAATTAGCATTGTCGAACATAAATTCGTTGAGATCATATGAAGTTGTCGACGAAATTAAGGAAGCTTTGGAGATTGTGTGTCCGAATGTTGTCTCTTGTGCTGAT
ATTTTAATCATTGCTGCTAGAGATGCTGTTCTTCTG
AGTGGAGGACCAAATTGGGAAGTGAAATTAGGGAGGAAAGACAGCCTAACAGCCAGCCAAGAAGCTTCAAACGACATAATGCCG
AGCCCACGAGCCAATGCAAGTTCCTTAATTACCCTCTTCGCCAAATTCAACCTCACCGTCAAAGACTTGGTCGCCCTCTCCGGGTCCCACTCCATCGGAAAAGCAAGGTGCTTCTCCATA
GTCTTCCGGCTCTACAACCAATCGGGCACGGGCCGGCCCGACCCATCGATCGACCCGGATTACCGCGAGAAGCTAGACGGGTTATGCCCGCTCGGCGGCGACGAAGAAGTCACCGGAGAT
CTAGATTCTACGCCGGAGATATTCGATAATCGGTATTTCAAGGACTTGGTTAATGGGAGGGGGTTTTTGAACTCGGACGAGACTTTGTTCACGTTTGATGAGACTAGGGTTTACGTGAAG
ATGTTTAGTGAGAGTGAGAGCGAGTTTTTCAAAGCGTTTGTTGAGGGGATGATTAAGTTGGGGGATCTGCAGTCGGGGTTTCCCGGCGAGATTAGGAGGAGTTGTAGGGCGGTGAACGGG
CGGCCGGTGGAGGAGGTGTTGGTGGCGACAAAGCGGTGA

Retrieve as FASTA