Entry information : MguPrx29 ( mgv1a009821m)
Entry ID 9198
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-18 (Christophe Dunand)
Peroxidase information: MguPrx29 ( mgv1a009821m)
Name (synonym) MguPrx29 ( mgv1a009821m)
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx29
start..stop
S start..stop
MguPrx27 635 0 1..330 1..331
MguPrx108 511 0 3..330 7..333
MguPrx22 511 0 3..330 7..333
MguPrx02 497 5e-179 11..330 8..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52556..52786 231 N° 2 52969..53727 759  
join(52556..52786,52969..53727)


exon

Literature and cross-references MguPrx29 ( mgv1a009821m)
DNA ref. Phytozome 12:   scaffold_16 (52556..53727)
Protein sequence: MguPrx29 ( mgv1a009821m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   35661.5 (33138.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.94 (8.90) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTKLAAIALFLSCLVFLVSVSSAANSTAGLKVGFYRKSCPPAEAIVQKYVNKFVFRNPGFAAGLIRLHFHDCFVRGCDASVLLDGANSEKQSIPNRGSLRGFEIIDAAKAELEIRCPGIVSCADILAFAARDSSWRVGDIFYEVPAGRRDGNESNTLDPLLNLPPPFFNATQLRDNFARKGLTLDEMVTLSGAHSIGIAHCTSFNGRLYPTVDPTLDPNYAVFLRNICPAPVANATGPPSVNPTVNQDVITPKRLDNLYYELLKQKKGLLTSDQVLMTSTLTSKIVLKNAQNSPAWAKKFAAAMVKMGKIDVLTGTQGEIRENCRLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCACCAAATTGGCAGCCATTGCGTTGTTCTTGTCTTGCTTGGTTTTCCTTGTTTCGGTTTCTTCTGCGGCTAATTCAACAGCCGGCCTCAAAGTTGGCTTCTACAGAAAATCA
TGCCCACCCGCAGAAGCCATTGTCCAAAAATACGTCAACAAATTCGTCTTCCGCAACCCTGGATTTGCCGCTGGCCTTATCAGGCTTCATTTCCACGACTGCTTCGTCAGG
GTACGTATG
AGCGTTATTGTACATATTTATTATAATATGCATGTATTATCATGCATCTTCGTAATCGTATATATATACATACACCCGCACTAGCTATATATATTGATGCATGTTGATGACCTAGCTAAT
TATATTGAGTATTAACACTATATCTACTAATAATTTATTGCTTTTGTTTACAGGGATGTGATGCTTCTGTGTTGTTGGACGGAGCAAACTCGGAAAAACAAAGTATACCAAACCGGGGAA
GCTTAAGAGGTTTTGAGATAATCGACGCAGCAAAAGCTGAATTGGAGATTCGATGCCCTGGAATCGTTTCTTGTGCCGACATTCTCGCATTTGCCGCAAGAGACAGCTCATGGAGAGTTG
GTGACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAACGAGTCCAACACACTCGACCCACTTCTCAATCTTCCCCCACCTTTCTTCAACGCCACTCAACTCAGGGACAATTTTG
CAAGAAAGGGTCTCACACTCGACGAAATGGTGACACTCTCAGGGGCTCACTCCATTGGAATTGCTCACTGCACCTCCTTCAACGGACGTCTATACCCGACCGTAGACCCCACTCTCGACC
CTAACTACGCCGTTTTCTTGAGAAATATCTGCCCGGCCCCCGTTGCTAATGCCACAGGTCCACCAAGTGTGAACCCTACGGTGAATCAGGATGTCATAACTCCGAAACGTTTGGACAATT
TGTACTACGAGCTGCTGAAGCAGAAAAAGGGACTTCTTACGTCGGATCAGGTACTTATGACAAGCACTTTGACCTCCAAAATTGTACTGAAAAATGCTCAGAACAGTCCTGCATGGGCTA
AGAAGTTCGCCGCTGCAATGGTCAAAATGGGCAAGATTGACGTGCTCACCGGCACCCAGGGCGAGATCCGAGAAAACTGCCGCCTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCACCAAATTGGCAGCCATTGCGTTGTTCTTGTCTTGCTTGGTTTTCCTTGTTTCGGTTTCTTCTGCGGCTAATTCAACAGCCGGCCTCAAAGTTGGCTTCTACAGAAAATCA
TGCCCACCCGCAGAAGCCATTGTCCAAAAATACGTCAACAAATTCGTCTTCCGCAACCCTGGATTTGCCGCTGGCCTTATCAGGCTTCATTTCCACGACTGCTTCGTCAGG
GGATGTGAT
GCTTCTGTGTTGTTGGACGGAGCAAACTCGGAAAAACAAAGTATACCAAACCGGGGAAGCTTAAGAGGTTTTGAGATAATCGACGCAGCAAAAGCTGAATTGGAGATTCGATGCCCTGGA
ATCGTTTCTTGTGCCGACATTCTCGCATTTGCCGCAAGAGACAGCTCATGGAGAGTTGGTGACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAACGAGTCCAACACACTCGAC
CCACTTCTCAATCTTCCCCCACCTTTCTTCAACGCCACTCAACTCAGGGACAATTTTGCAAGAAAGGGTCTCACACTCGACGAAATGGTGACACTCTCAGGGGCTCACTCCATTGGAATT
GCTCACTGCACCTCCTTCAACGGACGTCTATACCCGACCGTAGACCCCACTCTCGACCCTAACTACGCCGTTTTCTTGAGAAATATCTGCCCGGCCCCCGTTGCTAATGCCACAGGTCCA
CCAAGTGTGAACCCTACGGTGAATCAGGATGTCATAACTCCGAAACGTTTGGACAATTTGTACTACGAGCTGCTGAAGCAGAAAAAGGGACTTCTTACGTCGGATCAGGTACTTATGACA
AGCACTTTGACCTCCAAAATTGTACTGAAAAATGCTCAGAACAGTCCTGCATGGGCTAAGAAGTTCGCCGCTGCAATGGTCAAAATGGGCAAGATTGACGTGCTCACCGGCACCCAGGGC
GAGATCCGAGAAAACTGCCGCCTCGTCAAC

Retrieve as FASTA