Entry information : AtPrx11 (At1g68850 / PER11 / Atp23a / AtP123)
Entry ID 92
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx11 (At1g68850 / PER11 / Atp23a / AtP123)
Name (synonym) AtPrx11 (At1g68850 / PER11 / Atp23a / AtP123)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Green siliques
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx11
start..stop
S start..stop
AlyPrx11 676 0 2..336 1..335
TsPrx11 660 0 2..336 1..335
BrPrx11-1Ab_other 655 0 2..336 1..335
BstrPrx23 652 0 2..336 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25884953..25885177 225 N° 2 25884660..25884851 192 N° 3 25884374..25884539 166 N° 4 25883806..25884233 428
complement(join(25883806..25884233,25884374..25884539,25884660..25884851,2588495 3..25885177))


exon

Literature and cross-references AtPrx11 (At1g68850 / PER11 / Atp23a / AtP123)
Protein ref. UniProtKB:   Q96519
DNA ref. Phytozome 12:   Chr1 (25885177..25883806)
mRNA ref. GenBank:   NM_105559
Cluster/Prediction ref. Phytozome Gene 12:   19656726 UniGene:   At.87
Omic ref. AtProteome:   At1g68850 ATTED-II:   At1g68850 e-FP Browser:   At1g68850 ePlant:   At1g68850 Genevestigator:   At1g68850 TAIR:   At1g68850
Protein sequence: AtPrx11 (At1g68850 / PER11 / Atp23a / AtP123)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (316)
PWM (Da):   %s   37187.68 (34727.4)  
PI (pH):   %s   4.97 (4.78) Peptide Signal:   %s   cut: 21 range:21-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRLLFVFFMVHTIFIPCFSFDTPGKDLPLTLDYYKSTCPTVFDVIKKEMECIVKEDPRNAAIIIRLHFHDCFVQGCDGSVLLDETETLQGEKKASPNINSLKGYKIVDRIKNIIESECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFYSQGLSVEDMVALIGAHTIGKAQCRNFRSRIYGDFQVTSALNPVSETYLASLREICPASSGEGDSNVTAIDNVTPNLFDNSIYHTLLRGEGLLNSDQEMYTSLFGIQTRRIVSKYAEDPVAFFEQFSKSMVKMGNILNSESLADGEVRRNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 5 cDNA and 8 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCTGCTGTT ACTGTTTTGT ATTTTCTAGC ATTTATTTTA CAATTTTGTT CCTAACCTTC TAACATAGCA AATTAGCAAT CATAAACTTT TATGCATATA TATAAGTGTA AGACAGTAAA  TCTTGTATGT GGAAAGACAT TTTCCTTCAA AATATAAGTT CATAAACGTC AAGTCAATTA TGGTCGACTC TCTTTAGAGT ACATACTACA TAGATTAGAT TCAGTCGGAT TTAATGTGTA  CTTAACTTTT TAACTTGCAG GTCTTGCATG ACAAGAGTCG TGTCACAAGA CCATTAAAGT CACTGAAGTT TGTGTTTATG GTGCACATTG ACATCATGTA GATGGTATTT TGATGTAAAC  GAATGATATA TTTGTAATAT TACAACTTCA AAGGTTACAT CTAAATTTTG AGACTTCGAT GATTTGTTTT TTCTTCGAAT CACTCCTGCG ACTATGCATC AGCCAAATCC CAAATGTGTG  TCAACATCTC GAAAGCACAA TCCTCATTCG TTTTTTACTG AGTGTGTGTC TTTCCCAAGC AATATATTCA AAAAAAGTAG AAAGTAAATG GCCCATGCAG GTTTCGAACC TGCGACCTTC  GCGTTATTAG CACGACGCTC TAACCAACTG AGCTAATGGG CCATTTTGCA ATGACTTGTT TTCTTCTAAT AATACTATTT TCAAACTTGT GATTGCACAG TTGCACATTC TCGAGGCTTG  GAGATGTTAT TAGTTTAAAA AACTCTATTA AGGTGCATAA GTCAGGTTCA AATCTAAGAG GTCAACACAA TCCTCTACCA TTATACCAAA ACCACCTAAC ACTAGTTTTT TTCAACTAAT  GCATGTAGCC CTGCCAATAT ATAACCTTGT TTTTAACCGT TTTTAAGACT GAAAATATTC TTAAAATAAT AACAAGTTGA CGACAAATAA ATAATTCAAA TTTTAGCGAA GATCGCGTTG  TTACTATTTT AATAAATATT GGACTTTCAT TTTTTTATGT AATCGTATAA TTCAAGATGC CGCCAAAGAG TGGATCTTAT TTTCCCTCCT ACTTTTTCAT CTAGATTTTT CGTCATAGGA  AGAAAGAACA GAGAAAGAGA AGAACACTTA GCAAAATTAT TTCCAAGGAA ATGATATAAT TAAGCTCCCG CTACACCTAC ACAAAGTTTA CGAGGTTGAG AGTATTTAAT AAAATTTATA  AAGCTCGACT TAAATAACTC AAAAAGAGTT GGGAACCTAT TTGCGACCTA TATATCTCAC TAATTACTCA TGATATTATT CTTAACAATA GACAGATTTA GTTCCAAACT AACTACGGAA  ACATTGAAAA AGAAGTTTAG TTGATTTATC TAACATGCAT GAAATAATAT GGACAAGGAT TTGTACTTTG TAGTTGCCAT GGTCGTGTCA ACAACATAGT TCAAATCCTA TTGAGACTAT  GCAAATTCAT TTCTGGAACT ACATTATATG TATTCTTTTT TATCCGAAAA AAACACTAAA TATTTCTTAG GTGAACAAAA AAAAGAGAAG TAGATAGTTC CGGAGCAGAA CAAAACAGTT  GAACGAATTA CAAAAGAACG AGAATTCTAG ATTTGTTTCA AGAATCAGTT TTGATGTGCT TGCAACTTTT GCAAACATAC AAACAAATAT ATCTGCCTTA ATAACAAAAG TGGAATATGA  ATCGGAAAAA ATAGTACACT TTTATGGTAA TATAATAATT TGGGTTGGTA ATAATCTGCA CTAGAATTCA AATAAATTTT CATCTAGTTA CCTTTGGGTC ATAGGAGAAC CCAACAACCA  TCTCACAAAA TTAGTTGCAT CTCACTTGAC CTACTTCTCA AGACCCTTGT AACACAAGAA AACTAAAAAC TCTACAATGC CCTCTTCTCA AAAAATTATA TATCTCTGGG AAGTCTCAAC 
CATCTTCTCT AACTCCTATC TCAACACACA TATTTTCCCA AAATTTGGAT CAAAAAGTTT TCCGATAGAA GAAATTAAAT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCATCAACA ACGAAACTAA AAAATGGAGA AAATAATCTA TTTCTGATCT TTATTTATAT AAGAAAGAAA AAATTTAATT TGATGTTATT CTTTCCCTTA TTTATTTCTA CATTTTTAAA  ACTATAGGGT TCTTGAATGT TTAAAACCTT ATTCTAATGA TTTTCAATTG ATCTGAGTCT GTAGTTGTTT TTTTGGTTTG ACTTTATATT TATGGTTGTG CATGCAACAA AATCAATAAA  ATAATTGCAC TATATATGCA AAAACTCAAA CTCCAATATT GTAAGTTCGA AAGAAGAAAT AATTCTTTTC AAAAAATGTA TAATGAAATT TAAGGTTGAT AAAGAGACAA GCAAAGCAAA  ATTCTGCTCA TGTAAAAGAT AGAGTTTCTA AGAATTTAGC ATGGAAACAG GCTAAAGACG TCAAGACTCG ATCTCACCTA CTTGATACTG GAAGCAGGAT ACGACAAAGT GGACAATTTT  GAGATTGTTG CATCCAGTCT TCAATGCAGA AAGTATGGAA AACATGAGAA CAAGAAGAAG TAACGGTTGC TTCCATCCCA AGAAAGAAAT CTTCTTGACA TATACAACAT GTGCCAAACA  AATCCATGTC AGGGCCAAGC ACTGCCACAC ATTTGTTATC AGGATGCAAT CTTTTGGAAA ATTTGGTGAA AAGTAGTTGG AGTTTTTCAC CCATGTCACC AAACGATTAA TATAAGAATC  CGGGAAGTGA GTAAAACCGA ACTCATTCAT CACACCTCTA ATAACCCTCA CTAGATAATC GACGCTTTCA TCTCTATATA AGAGAATGTA TCTTGTACAA TTATTCATAT CAGAGTCTAT  TATAATTTTT CCTAAACACC TTTGTGTTCT TACCCTCATC AAATTTATCA GTACCATTCC TTTTTTCTCG ACATGAACAA CAGAGGAACC CATCTCTGCT TTGACCAAGT CCTCCTCTGC 
TTCATTAAGT GATCTGCTAG TCCACGGACG ATGCTGGCCT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGACTCCTCTTTGTATTCTTCATGGTTCACACCATCTTTATCCCATGCTTTTCCTTTGATACACCGGGGAAGGATCTTCCTTTAACCCTAGATTATTACAAGTCTACTTGTCCA
ACCGTATTTGACGTCATCAAGAAAGAAATGGAATGCATAGTGAAGGAAGATCCTAGAAATGCAGCCATAATTATTCGTCTTCACTTCCACGACTGCTTTGTCCAA
GTAAGTACACATCCA
CACCTTTCTTGAAACACAAGACATCATCCGCCAGAGAAAATTCATAACTGATATGTCAAACTTTTACTGCTATCAAATACTTACAGGGATGTGATGGATCGGTGTTGCTAGACGAGACAG
AAACTCTACAGGGAGAGAAGAAAGCTTCTCCCAACATAAATTCATTGAAAGGATACAAAATTGTCGACAGAATCAAGAACATAATCGAATCCGAATGTCCTGGAGTTGTTTCATGCGCTG
ATCTTCTCACAATTGGTGCTAGAGATGCTACAATCCTG
GTAAGATATACACAAACGAAACATATACTCTCTCAAATCTCAATATAAATACTGTATATTGTAAGTATCGTATGAATTATGA
AATGAAATAAAATTTTGATTTTGTGTTTGTGTTTGAAGGTGGGTGGGCCTTACTGGGATGTTCCTGTGGGAAGAAAAGATTCAAAAACCGCAAGCTACGAGCTTGCCACAACAAACCTTC
CAACTCCAGAAGAGGGTTTAATCAGCATCATTGCTAAGTTCTATTCTCAAGGTCTCTCGGTTGAAGACATGGTCGCTCTTATAG
GTAAGATCAATCCTCTTAACCAAACTAAACCGAAAT
TCCTTGTAATAGAAGTTAAAACCATATGATTGAATATAATATGATATAAAATGTCGTAAACCGGATTACTAAAACCCTAACTTGACCAATAATCTATCTCCTAGGAGCGCACACGATCGG
AAAAGCACAATGTCGCAACTTCCGATCCCGAATTTATGGAGATTTTCAAGTGACGTCAGCCCTAAATCCAGTTTCGGAGACGTACTTGGCAAGTCTTCGAGAGATTTGTCCGGCGAGTAG
CGGAGAAGGTGATAGTAACGTGACGGCGATAGACAATGTGACGCCGAATCTCTTCGATAACTCGATCTACCACACACTGCTAAGAGGAGAAGGGTTACTGAATTCGGACCAGGAGATGTA
CACGAGCTTGTTCGGGATACAAACGCGGCGAATCGTGAGCAAGTATGCGGAGGATCCAGTGGCTTTCTTCGAGCAATTCTCGAAGTCGATGGTAAAGATGGGGAACATTTTGAACTCTGA
AAGCTTGGCTGATGGAGAAGTTAGAAGAAATTGCAGATTTGTGAATACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGACTCCTCTTTGTATTCTTCATGGTTCACACCATCTTTATCCCATGCTTTTCCTTTGATACACCGGGGAAGGATCTTCCTTTAACCCTAGATTATTACAAGTCTACTTGTCCA
ACCGTATTTGACGTCATCAAGAAAGAAATGGAATGCATAGTGAAGGAAGATCCTAGAAATGCAGCCATAATTATTCGTCTTCACTTCCACGACTGCTTTGTCCAA
GGATGTGATGGATCG
GTGTTGCTAGACGAGACAGAAACTCTACAGGGAGAGAAGAAAGCTTCTCCCAACATAAATTCATTGAAAGGATACAAAATTGTCGACAGAATCAAGAACATAATCGAATCCGAATGTCCT
GGAGTTGTTTCATGCGCTGATCTTCTCACAATTGGTGCTAGAGATGCTACAATCCTG
GTGGGTGGGCCTTACTGGGATGTTCCTGTGGGAAGAAAAGATTCAAAAACCGCAAGCTACGAG
CTTGCCACAACAAACCTTCCAACTCCAGAAGAGGGTTTAATCAGCATCATTGCTAAGTTCTATTCTCAAGGTCTCTCGGTTGAAGACATGGTCGCTCTTATAG
GAGCGCACACGATCGGA
AAAGCACAATGTCGCAACTTCCGATCCCGAATTTATGGAGATTTTCAAGTGACGTCAGCCCTAAATCCAGTTTCGGAGACGTACTTGGCAAGTCTTCGAGAGATTTGTCCGGCGAGTAGC
GGAGAAGGTGATAGTAACGTGACGGCGATAGACAATGTGACGCCGAATCTCTTCGATAACTCGATCTACCACACACTGCTAAGAGGAGAAGGGTTACTGAATTCGGACCAGGAGATGTAC
ACGAGCTTGTTCGGGATACAAACGCGGCGAATCGTGAGCAAGTATGCGGAGGATCCAGTGGCTTTCTTCGAGCAATTCTCGAAGTCGATGGTAAAGATGGGGAACATTTTGAACTCTGAA
AGCTTGGCTGATGGAGAAGTTAGAAGAAATTGCAGATTTGTGAATACATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTCCTATC TCAACACACA TATTTTCCCA AAATTTGGAT CAAAAAGTTT TCCGATAGAA GAAATTAAAT ATGATGAGAC TCCTCTTTGT ATTCTTCATG GTTCACACCA TCTTTATCCC  ATGCTTTTCC TTTGATACAC CGGGGAAGGA TCTTCCTTTA ACCCTAGATT ATTACAAGTC TACTTGTCCA ACCGTATTTG ACGTCATCAA GAAAGAAATG GAATGCATAG TGAAGGAAGA  TCCTAGAAAT GCAGCCATAA TTATTCGTCT TCACTTCCAC GACTGCTTTG TCCAAGGATG TGATGGATCG GTGTTGCTAG ACGAGACAGA AACTCTACAG GGAGAGAAGA AAGCTTCTCC  CAACATAAAT TCATTGAAAG GATACAAAAT TGTCGACAGA ATCAAGAACA TAATCGAATC CGAATGTCCT GGAGTTGTTT CATGCGCTGA TCTTCTCACA ATTGGTGCTA GAGATGCTAC  AATCCTGGTG GGTGGGCCTT ACTGGGATGT TCCTGTGGGA AGAAAAGATT CAAAAACCGC AAGCTACGAG CTTGCCACAA CAAACCTTCC AACTCCAGAA GAGGGTTTAA TCAGCATCAT  TGCTAAGTTC TATTCTCAAG GTCTCTCGGT TGAAGACATG GTCGCTCTTA TAGGAGCGCA CACGATCGGA AAAGCACAAT GTCGCAACTT CCGATCCCGA ATTTATGGAG ATTTTCAAGT  GACGTCAGCC CTAAATCCAG TTTCGGAGAC GTACTTGGCA AGTCTTCGAG AGATTTGTCC GGCGAGTAGC GGAGAAGGTG ATAGTAACGT GACGGCGATA GACAATGTGA CGCCGAATCT  CTTCGATAAC TCGATCTACC ACACACTGCT AAGAGGAGAA GGGTTACTGA ATTCGGACCA GGAGATGTAC ACGAGCTTGT TCGGGATACA AACGCGGCGA ATCGTGAGCA AGTATGCGGA  GGATCCAGTG GCTTTCTTCG AGCAATTCTC GAAGTCGATG GTAAAGATGG GGAACATTTT GAACTCTGAA AGCTTGGCTG ATGGAGAAGT TAGAAGAAAT TGCAGATTTG TGAATACATG  ATTCATCAAC AACGAAACTA AAAAATGGAG AAAATAATCT ATTTCTGATC TTTATTTATA TAAGAAAGAA AAAATTTAAT TTGATGTTAT TCTTTCCCTT ATTTATTTCT ACATTTTTAA 
AACTATAGGG TTCTTGAATG TTTAAAACCT TATTCTAATG ATTTTCAATT GATCTGAGTC TGTAGTTGTT T 

Retrieve as FASTA