Entry information : SbPrx135 (Sobic.010G161700.1 [2.1] / SB10G021620 [1.4])
Entry ID 920
Creation 2006-01-06 (Christophe Dunand)
Last sequence changes 2006-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx135 (Sobic.010G161700.1 [2.1] / SB10G021620 [1.4])
Name (synonym) SbPrx135 (Sobic.010G161700.1 [2.1] / SB10G021620 [1.4])
Class Class III peroxidase    [Orthogroup: Prx109]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Leaves
Seedlings
Inducers Abscissic acid treatment
Pathogen interaction
Phosphate starvation
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx135
start..stop
S start..stop
SbPrx134 602 0 1..313 1..314
ZmPrx48 580 0 1..313 1..313
SiPrx37 560 0 1..313 1..311
CciPrx01 508 0 1..313 1..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47756150..47756356 207 N° 2 47756442..47756621 180 N° 3 47756731..47757285 555  
join(47756150..47756356,47756442..47756621,47756731..47757285)


exon

Literature and cross-references SbPrx135 (Sobic.010G161700.1 [2.1] / SB10G021620 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_10 (47756150..47757285)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.14734.1
Protein sequence: SbPrx135 (Sobic.010G161700.1 [2.1] / SB10G021620 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (291)
PWM (Da):   %s   32957.36 (30733.2)  
PI (pH):   %s   7.89 (7.98) Peptide Signal:   %s   cut: 23 range:23-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPTLMQCLVAISLLSCVAHAQLSTTFYASSCPKLQSIVRKAMIQALSNDQRMGASLLRLFFHDCFVQGCDGSILLDAGGEKTAGPNANSVRGYEVIDTIKTNVEAACPGVVSCADILALAAREGTNLLGGPTWNVPLGRRDSTTASASLANSNLPPATASLGTLISLFGRQGLSARDMTALSGAHSIGQARCTTFRSRIYGDTNINASFAALRQQTCPQSGGDGNLASIDEQTPTRFDTDYYTNLMLQRGLFHSDQELFNGGSQDALVRQYSASSSLFNSDFVAAMIKMGNVGVLTGTAGQIRRNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, introns 1 and 2) and 3 ESTs (TC102065) and from 2 ESTs (TC102067).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTCCTACCTTGATGCAATGCTTGGTCGCCATTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGACCACGTTCTATGCGTCCTCCTGCCCCAAGCTGCAGAGCATCGTG
CGGAAGGCGATGATCCAGGCCCTCAGCAATGACCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GTACTAGCTAGAATCCTCACACTATTCAGATCA
AGTTCTCCGCCGGTAACAGTACGTACGTAATAACAGTATGTGATGATGACAGGGTTGCGACGGCTCGATCCTTCTCGACGCCGGAGGGGAGAAGACGGCAGGCCCCAACGCCAACTCGGT
GCGCGGCTATGAGGTCATCGACACCATCAAGACGAACGTGGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTCGCCCTTGCCGCGCGAGAAGGAACGAATCTG
GTACGCAC
GCCTACTAGTTTGTTTGTTTGTTTAATTACATGTCATATTCAGTTAGTTAATGACGCGTCTAACACTTATCCTTCGTTTGTTGTTGTCCGCACGTACGTAGCTCGGCGGGCCGACCTGGA
ACGTGCCGCTGGGCCGGCGGGACTCGACGACGGCGAGCGCGTCCCTCGCCAACAGCAACCTCCCGCCGGCGACGGCCAGCCTGGGCACGCTCATCTCGCTGTTCGGCAGGCAGGGCCTGT
CGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACTCCATCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGCATCTACGGCGACACCAACATCAACGCCTCCTTCGCGGCGCTCCGGC
AGCAGACGTGCCCGCAGTCCGGCGGCGACGGCAACCTGGCGTCCATCGACGAGCAGACGCCGACGAGGTTCGACACGGACTACTACACCAACCTGATGTTGCAACGGGGCCTGTTCCACT
CAGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCTCCTCGCTCTTCAACAGCGACTTCGTGGCGGCCATGATTAAGATGGGCAACGTTGGGG
TGCTTACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTCCTACCTTGATGCAATGCTTGGTCGCCATTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGACCACGTTCTATGCGTCCTCCTGCCCCAAGCTGCAGAGCATCGTG
CGGAAGGCGATGATCCAGGCCCTCAGCAATGACCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GGTTGCGACGGCTCGATCCTTCTCGACGCCGGA
GGGGAGAAGACGGCAGGCCCCAACGCCAACTCGGTGCGCGGCTATGAGGTCATCGACACCATCAAGACGAACGTGGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTCGCC
CTTGCCGCGCGAGAAGGAACGAATCTG
CTCGGCGGGCCGACCTGGAACGTGCCGCTGGGCCGGCGGGACTCGACGACGGCGAGCGCGTCCCTCGCCAACAGCAACCTCCCGCCGGCGACG
GCCAGCCTGGGCACGCTCATCTCGCTGTTCGGCAGGCAGGGCCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACTCCATCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGC
ATCTACGGCGACACCAACATCAACGCCTCCTTCGCGGCGCTCCGGCAGCAGACGTGCCCGCAGTCCGGCGGCGACGGCAACCTGGCGTCCATCGACGAGCAGACGCCGACGAGGTTCGAC
ACGGACTACTACACCAACCTGATGTTGCAACGGGGCCTGTTCCACTCAGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCTCCTCGCTCTTC
AACAGCGACTTCGTGGCGGCCATGATTAAGATGGGCAACGTTGGGGTGCTTACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA