Entry information : MguPrx34 (mgv1a009942m)
Entry ID 9203
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx34 (mgv1a009942m)
Name (synonym) MguPrx34 (mgv1a009942m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx34
start..stop
S start..stop
StPrx49 506 0 9..327 6..326
LePrx12 499 4e-180 9..327 6..326
LePrx15 494 3e-178 9..327 9..328
PtPrx27 494 7e-178 3..327 5..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 191752..191961 210 N° 2 192139..192336 198 N° 3 192452..192614 163 N° 4 193694..194100 407
join(191752..191961,192139..192336,192452..192614,193694..194100)


exon

Literature and cross-references MguPrx34 (mgv1a009942m)
DNA ref. Phytozome 12:   scaffold_52 (191752..194100)
Protein sequence: MguPrx34 (mgv1a009942m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   35364 (32835.7) Transmb domain:   %s   i5-24o
PI (pH):   %s   8.48 (8.39) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKNVGNNFVCLVVGLVLIASTNADLEMNYYAKSCPKAEKIVVDYVNKHIPNAPTLAAALIRMHFHDCFVRGCDASLLLNSTSSTGNRTEKVSPPNRTVRGFDFIDRLKSLLEAECPGVVSCADIVSLAARDAIVVTGGPFWRVPTGRRDGVISNASEALAQIPAPFSNISTLQNDFANKGLNLTDLVVLSGAHTIGISHCSSFANRLYNFTGVGDQDPSLDSEYATNLKANKCKSINSTTKVEMDPGSFRTFDLSYYKLVLKRRGLFESDAALTTNSITSSIINQIVNGDSKIFFKEFANSMEKMGRIGVKTGSVGEIRKHCALVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAAAAAATGTTGGGAATAATTTTGTGTGTTTGGTTGTAGGATTAGTACTAATTGCATCTACTAATGCTGATTTGGAGATGAATTACTATGCAAAATCATGCCCTAAAGCAGAGAAGATT
GTGGTGGATTATGTTAATAAGCACATCCCAAATGCTCCCACTCTTGCAGCTGCCTTGATTAGGATGCATTTCCATGATTGCTTTGTGAGG
GTAANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATT
TTAAAAAAAATATTTGATTTTTGACAGGGATGTGATGCATCATTGCTATTGAACTCCACATCGAGCACCGGAAACCGAACCGAAAAGGTTTCGCCACCAAATCGAACCGTCAGGGGATTC
GACTTCATCGACAGGCTGAAAAGCCTGCTGGAAGCCGAATGCCCTGGCGTCGTTTCTTGCGCGGATATCGTTTCTTTAGCTGCAAGAGATGCCATTGTTGTCACT
GTGAGCATATAAAAA
ACCAATCCAACTTCAACTACTCACTTTTTTCTTTTCATGAAATTTATTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAATTGCAGGGCGGTCCTTTTTGGAGAGT
GCCGACGGGGCGTCGAGATGGGGTGATATCGAATGCATCGGAAGCGTTAGCACAAATTCCAGCCCCATTCAGTAATATTTCTACACTTCAGAACGATTTTGCTAACAAGGGACTCAATCT
TACCGACCTCGTTGTCTTGTCCG
GTGAGCTATATATATGTAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGAATTTTGGGTTAACATTAGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNGTTAACATGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCCATA
AATGACATATATCTAAATTCAGGTGCTCACACCATCGGCATTTCTCATTGCTCCTCATTCGCGAACCGTCTCTACAATTTCACGGGCGTAGGAGATCAAGACCCATCTCTAGACAGCGAA
TACGCGACCAATCTAAAAGCTAACAAATGCAAGTCCATAAATTCGACAACTAAAGTGGAAATGGACCCCGGAAGTTTCAGAACATTCGATCTCAGTTACTACAAGCTTGTCCTAAAACGA
AGGGGCTTGTTCGAATCCGATGCAGCACTCACAACCAATTCGATAACCAGCTCGATTATTAATCAAATCGTGAACGGAGATTCCAAGATTTTCTTTAAGGAATTTGCGAACTCTATGGAG
AAAATGGGAAGGATTGGAGTTAAGACGGGGTCCGTTGGCGAAATTCGAAAGCATTGTGCTCTTGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAAAAAATGTTGGGAATAATTTTGTGTGTTTGGTTGTAGGATTAGTACTAATTGCATCTACTAATGCTGATTTGGAGATGAATTACTATGCAAAATCATGCCCTAAAGCAGAGAAGATT
GTGGTGGATTATGTTAATAAGCACATCCCAAATGCTCCCACTCTTGCAGCTGCCTTGATTAGGATGCATTTCCATGATTGCTTTGTGAGG
GGATGTGATGCATCATTGCTATTGAACTCC
ACATCGAGCACCGGAAACCGAACCGAAAAGGTTTCGCCACCAAATCGAACCGTCAGGGGATTCGACTTCATCGACAGGCTGAAAAGCCTGCTGGAAGCCGAATGCCCTGGCGTCGTTTCT
TGCGCGGATATCGTTTCTTTAGCTGCAAGAGATGCCATTGTTGTCACT
GGCGGTCCTTTTTGGAGAGTGCCGACGGGGCGTCGAGATGGGGTGATATCGAATGCATCGGAAGCGTTAGCA
CAAATTCCAGCCCCATTCAGTAATATTTCTACACTTCAGAACGATTTTGCTAACAAGGGACTCAATCTTACCGACCTCGTTGTCTTGTCCG
GTGCTCACACCATCGGCATTTCTCATTGC
TCCTCATTCGCGAACCGTCTCTACAATTTCACGGGCGTAGGAGATCAAGACCCATCTCTAGACAGCGAATACGCGACCAATCTAAAAGCTAACAAATGCAAGTCCATAAATTCGACAACT
AAAGTGGAAATGGACCCCGGAAGTTTCAGAACATTCGATCTCAGTTACTACAAGCTTGTCCTAAAACGAAGGGGCTTGTTCGAATCCGATGCAGCACTCACAACCAATTCGATAACCAGC
TCGATTATTAATCAAATCGTGAACGGAGATTCCAAGATTTTCTTTAAGGAATTTGCGAACTCTATGGAGAAAATGGGAAGGATTGGAGTTAAGACGGGGTCCGTTGGCGAAATTCGAAAG
CATTGTGCTCTTGTCAAT

Retrieve as FASTA