Entry information : MguPrx35 (mgv1a009971m)
Entry ID 9204
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx35 (mgv1a009971m)
Name (synonym) MguPrx35 (mgv1a009971m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx35
start..stop
S start..stop
SbaPrx01 495 1e-178 8..324 2..321
EgrPrx43 488 1e-175 9..325 10..322
EcamPrx43 487 3e-175 9..325 10..322
EgrPrx45 483 1e-173 9..325 10..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 564483..564692 210 N° 2 564198..564389 192 N° 3 563951..564116 166 N° 4 563332..563738 407
complement(join(563332..563738,563951..564116,564198..564389,564483..564692))


exon

Literature and cross-references MguPrx35 (mgv1a009971m)
DNA ref. Phytozome 12:   scaffold_104 (564692..563332)
Protein sequence: MguPrx35 (mgv1a009971m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35103.27 (32500.0)  
PI (pH):   %s   7.26 (7.70) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCKQFQTFVSVLLFLCIVESEAQLQTGFYRSSCGIAEFIVKQEVRNGFFKDNGIAAGLVRLHFHDCFVRGCDGSVLIDSTASNKAEKDSPANNPSLRGFEVIDNAKARIEAFCKGVVSCADILAFAARDSIEITGGFGYDVPSGRKDGRVSLDTEASQNLPPPSFNVNQLTQAFANKGLTQEEMVTLSGAHTLGRSHCTSFSNRLYSFSTNTSQDPSLDAFYASQLRQQCPRGTGPNPVVPMDPFSPAQTDVGYYRGVLSNRGLFTSDQTLMTSPITQAQVFQNAQNPFLWANKFAAAMVNMGKIGVLTGNSGEIRASCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGCAAACAATTTCAGACATTTGTTTCAGTGCTTTTGTTTCTGTGCATTGTTGAGTCAGAAGCTCAACTTCAGACGGGGTTTTATCGAAGCTCGTGTGGCATAGCCGAGTTTATA
GTTAAACAAGAAGTCAGAAATGGCTTCTTCAAAGACAATGGGATTGCTGCTGGACTTGTTAGATTACATTTTCATGACTGTTTTGTCAGG
GNNNNNNNNNNNNNNNNNNNNNNCACATTT
TACAACAATATTCTTCATGCATATAAACTAGGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGATGTGATGGATCGGTGCTGATAGATTCCACGGCATCAAACAAGGCGGAGAAAGAT
TCACCGGCGAACAATCCGAGCCTAAGAGGATTTGAAGTAATCGATAATGCAAAGGCCAGGATTGAAGCCTTTTGTAAAGGCGTTGTTTCGTGTGCTGATATACTTGCTTTTGCAGCTCGT
GATAGTATCGAGATC
GTAAGCTAGCTAGTTCTATATACCGTACCGTTTTTCAGTCATAATTTAACGCACGATTTAATTAATACATTTATTTTTCAGACAGGAGGATTTGGGTACGATGTC
CCTAGTGGGAGGAAAGATGGGAGAGTTTCTTTAGATACAGAGGCATCACAAAATCTGCCACCTCCTTCTTTTAATGTTAATCAACTCACTCAAGCTTTTGCTAATAAAGGTTTAACTCAA
GAAGAAATGGTTACCCTTTCTG
GTAATTAATTAACATCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAATGGAATTTGATTACTTTTCTACTTAAAAAAAAAAAAAAACTAATTTCATGTTATTTTGTTACTTGCAGGAGCGC
ACACATTAGGTAGGTCCCACTGCACGTCATTCAGCAACAGGCTGTACAGTTTCAGCACAAACACGAGCCAAGATCCGAGCCTAGATGCGTTTTACGCGAGCCAGCTGAGGCAACAGTGTC
CACGTGGCACGGGCCCGAATCCGGTGGTCCCCATGGACCCATTCAGCCCGGCCCAGACCGATGTGGGTTACTACAGAGGTGTATTGTCTAATAGAGGCCTTTTTACCTCGGACCAAACCC
TAATGACAAGCCCAATAACACAGGCCCAAGTTTTCCAAAATGCTCAGAACCCTTTCCTTTGGGCAAACAAATTTGCTGCTGCTATGGTTAATATGGGCAAGATTGGTGTTTTAACTGGTA
ATTCTGGTGAGATTAGAGCTAGTTGTAGAGTGATTAACAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGCAAACAATTTCAGACATTTGTTTCAGTGCTTTTGTTTCTGTGCATTGTTGAGTCAGAAGCTCAACTTCAGACGGGGTTTTATCGAAGCTCGTGTGGCATAGCCGAGTTTATA
GTTAAACAAGAAGTCAGAAATGGCTTCTTCAAAGACAATGGGATTGCTGCTGGACTTGTTAGATTACATTTTCATGACTGTTTTGTCAGG
GGATGTGATGGATCGGTGCTGATAGATTCC
ACGGCATCAAACAAGGCGGAGAAAGATTCACCGGCGAACAATCCGAGCCTAAGAGGATTTGAAGTAATCGATAATGCAAAGGCCAGGATTGAAGCCTTTTGTAAAGGCGTTGTTTCGTGT
GCTGATATACTTGCTTTTGCAGCTCGTGATAGTATCGAGATC
ACAGGAGGATTTGGGTACGATGTCCCTAGTGGGAGGAAAGATGGGAGAGTTTCTTTAGATACAGAGGCATCACAAAAT
CTGCCACCTCCTTCTTTTAATGTTAATCAACTCACTCAAGCTTTTGCTAATAAAGGTTTAACTCAAGAAGAAATGGTTACCCTTTCTG
GAGCGCACACATTAGGTAGGTCCCACTGCACG
TCATTCAGCAACAGGCTGTACAGTTTCAGCACAAACACGAGCCAAGATCCGAGCCTAGATGCGTTTTACGCGAGCCAGCTGAGGCAACAGTGTCCACGTGGCACGGGCCCGAATCCGGTG
GTCCCCATGGACCCATTCAGCCCGGCCCAGACCGATGTGGGTTACTACAGAGGTGTATTGTCTAATAGAGGCCTTTTTACCTCGGACCAAACCCTAATGACAAGCCCAATAACACAGGCC
CAAGTTTTCCAAAATGCTCAGAACCCTTTCCTTTGGGCAAACAAATTTGCTGCTGCTATGGTTAATATGGGCAAGATTGGTGTTTTAACTGGTAATTCTGGTGAGATTAGAGCTAGTTGT
AGAGTGATTAACAGC

Retrieve as FASTA