Entry information : MguPrx37 (mgv1a009981m)
Entry ID 9206
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx37 (mgv1a009981m)
Name (synonym) MguPrx37 (mgv1a009981m)
Class Class III peroxidase     [Orthogroup: Prx038]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx37
start..stop
S start..stop
PpePrx21 316 7e-108 1..325 1..324
VvPrx82 306 8e-104 4..325 6..325
MguPrx19 295 2e-99 19..325 25..334
SaPrx39 290 9e-98 1..324 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84831..85040 210 N° 2 84366..84729 364 N° 3 83835..84235 401  
complement(join(83835..84235,84366..84729,84831..85040))


exon

Literature and cross-references MguPrx37 (mgv1a009981m)
DNA ref. Phytozome 12:   scaffold_109 (85040..83835)
Protein sequence: MguPrx37 (mgv1a009981m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (305)
PWM (Da):   %s   35462.61 (33306.4)  
PI (pH):   %s   7.75 (8.00) Peptide Signal:   %s   cut: 21 range:21-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDLKIVLAIVLFLSPFGIEGLPNGLSFDYYSKSCPQVEKIVRDAMNSKVASDPKTPAAILRLVFHDCQVGGCDGSVLLNINDKKHDAEFDSPKNFGIRNRELIDEIKTKIEKVCPQKVSCADTLVLAARDGVAIAGGPTIKVPLGRKDTTTPHTREEADKGLPRNNVDLTKALQVFFQEVGITLEEVVAIIGAHTLGKTHCDGLKERLYLNSTKLPPGNEAEFVKYLKKTCPEGGPNQFTTTLDLDPTPQSFDNKYYVNVLNGHGLISLDAEIARDPRSIDIVKKFAHDQDAFFKVFSSAFVKISTLAVLTGDKGIVRKKCSVL

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTAAAAATAGTTTTAGCCATAGTCTTATTTCTTTCTCCGTTCGGAATTGAAGGATTGCCTAATGGCCTGTCGTTTGACTATTACAGTAAAAGTTGTCCGCAGGTCGAAAAAATC
GTTAGGGATGCAATGAATTCCAAGGTTGCATCCGATCCAAAAACTCCTGCAGCTATTCTAAGACTCGTGTTTCACGATTGCCAAGTCGGG
GTATGTATACATATCATCGATAATCATGTA
TATATATTTGAATGATATTTCTTTCNNNNNNNNNNNNNNNNNNNNNGTTTTGATTGGTATATTTTTTTTAGGGTTGCGATGGTTCTGTCCTTCTCAATATAAACGACAAAAAACATGATG
CGGAATTTGACTCGCCCAAGAATTTTGGAATAAGAAATAGAGAATTGATAGACGAAATTAAAACCAAGATCGAAAAAGTTTGCCCACAAAAAGTTTCGTGTGCTGACACTTTGGTGTTAG
CAGCTCGAGATGGTGTGGCTATAGCCGGAGGGCCTACGATCAAAGTCCCATTAGGGCGAAAAGACACAACTACCCCTCATACCCGAGAAGAAGCCGATAAAGGACTCCCGAGGAACAATG
TGGATCTTACTAAAGCCTTGCAGGTGTTTTTCCAAGAAGTTGGAATTACTTTGGAAGAAGTTGTCGCTATTATCG
GTAAATCGATTAAGTGAAATTATCATAGNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTTTAATTTGCAGGTGCACACACACTTGGGAAGACTCATTGTGATGGT
TTAAAGGAAAGATTATATCTCAATAGCACAAAATTACCTCCGGGAAACGAAGCCGAATTCGTAAAGTATTTAAAGAAAACTTGTCCGGAGGGAGGTCCAAACCAATTTACGACAACCTTA
GATCTCGACCCAACTCCTCAATCCTTCGACAACAAGTACTACGTAAACGTGCTCAATGGACATGGATTAATTTCGCTCGATGCAGAAATAGCAAGGGATCCTCGAAGTATCGATATTGTC
AAGAAATTTGCTCACGATCAAGACGCGTTTTTCAAGGTTTTCTCGTCGGCTTTTGTGAAGATTTCGACGCTCGCGGTTTTGACGGGAGATAAAGGAATCGTGAGGAAGAAATGTAGTGTG
TTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTAAAAATAGTTTTAGCCATAGTCTTATTTCTTTCTCCGTTCGGAATTGAAGGATTGCCTAATGGCCTGTCGTTTGACTATTACAGTAAAAGTTGTCCGCAGGTCGAAAAAATC
GTTAGGGATGCAATGAATTCCAAGGTTGCATCCGATCCAAAAACTCCTGCAGCTATTCTAAGACTCGTGTTTCACGATTGCCAAGTCGGG
GGTTGCGATGGTTCTGTCCTTCTCAATATA
AACGACAAAAAACATGATGCGGAATTTGACTCGCCCAAGAATTTTGGAATAAGAAATAGAGAATTGATAGACGAAATTAAAACCAAGATCGAAAAAGTTTGCCCACAAAAAGTTTCGTGT
GCTGACACTTTGGTGTTAGCAGCTCGAGATGGTGTGGCTATAGCCGGAGGGCCTACGATCAAAGTCCCATTAGGGCGAAAAGACACAACTACCCCTCATACCCGAGAAGAAGCCGATAAA
GGACTCCCGAGGAACAATGTGGATCTTACTAAAGCCTTGCAGGTGTTTTTCCAAGAAGTTGGAATTACTTTGGAAGAAGTTGTCGCTATTATCG
GTGCACACACACTTGGGAAGACTCAT
TGTGATGGTTTAAAGGAAAGATTATATCTCAATAGCACAAAATTACCTCCGGGAAACGAAGCCGAATTCGTAAAGTATTTAAAGAAAACTTGTCCGGAGGGAGGTCCAAACCAATTTACG
ACAACCTTAGATCTCGACCCAACTCCTCAATCCTTCGACAACAAGTACTACGTAAACGTGCTCAATGGACATGGATTAATTTCGCTCGATGCAGAAATAGCAAGGGATCCTCGAAGTATC
GATATTGTCAAGAAATTTGCTCACGATCAAGACGCGTTTTTCAAGGTTTTCTCGTCGGCTTTTGTGAAGATTTCGACGCTCGCGGTTTTGACGGGAGATAAAGGAATCGTGAGGAAGAAA
TGTAGTGTGTTGAAT

Retrieve as FASTA