Entry information : MguPrx42 ( mgv1a010067m)
Entry ID 9211
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2016-02-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-15 (Achraf Jemmat)
Peroxidase information: MguPrx42 ( mgv1a010067m)
Name (synonym) MguPrx42 ( mgv1a010067m)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx42
start..stop
S start..stop
VvPrx38 510 0 20..322 25..327
PtPrx08 501 1e-180 18..322 25..329
MePrx06 500 2e-180 20..322 26..328
AcoPrx61 491 6e-177 24..323 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 732374..732437 64 N° 2 732522..732670 149 N° 3 732796..732984 189 N° 4 733098..733263 166
N° 5 733941..734344 404  
join(732374..732437,732522..732670,732796..732984,733098..733263,733941..734344)


exon

Literature and cross-references MguPrx42 ( mgv1a010067m)
DNA ref. Phytozome 12:   scaffold_13 (732374..734344)
Protein sequence: MguPrx42 ( mgv1a010067m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   36215.56 (33335.9)  
PI (pH):   %s   6.92 (6.62) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLNHTFIVLLLPLLLQFYSVKSELQLNYYSKSCPRAEEIIKEQVAILYRKHGNTAVSWIRNLFHDCVVKSCDASLLLDTVVGVTSEKTAARSFGMRNFKYIDTIKDALEKECPLTVSCADIIALTARDGAALLKGPEIKMKTGRKDSKESYAAVVDKLIPNHNDSMSLVLSTFQSIGIDTEGTVALLGAHSVGRVHCRNIVQRIYPTVDPSLDPQYADYLKFRCPSPNPDPKVVDYVRNDLETPMELDNMYYKNLLSHKGLLLIDSELVSNPTTYPFVVKMAADNAYFHDQFSRALLILSENNPLSGDQGDIRKDCRFLNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns + 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTCAACCATACTTTTATCGTTCTGTTATTACCGTTGCTCTTGCAGTTTTATTCTGGTACGTTCAATTTCTTTTTTCTTTTAATTTGATTTTATTATTTTTTTTTATTTTTT
TTTAAATTGTCACAAAATGTATCTGCAGTTAAAAGTGAACTGCAGTTAAATTACTACTCAAAGAGTTGCCCAAGAGCAGAAGAGATTATCAAAGAACAAGTCGCCATTTTATACCGCAAG
CACGGAAACACCGCCGTTTCTTGGATCCGAAATCTCTTCCACGACTGCGTCGTTAAG
GTTGACATCGTCATTATATTTTAACCAATGTTTAATTTATTGTATGTATATTATATACATAGT
ACTAATAGTATTTTTTTTTAAATTTTATCTACGTCGGGGAAAAAAATTAAAAAATTATAAAGTCATGCGACGCATCGCTTTTATTGGACACGGTAGTTGGAGTGACGTCGGAGAAAACGG
CGGCGAGGAGTTTCGGGATGAGAAATTTCAAGTACATAGACACAATAAAAGATGCACTTGAGAAGGAGTGCCCCTTGACTGTTTCTTGTGCTGATATTATTGCTCTTACTGCTAGAGATG
GTGCAGCCCTG
GTAATTTTTAATTTTAATTAAAAATGTATTTATTTAATTTTAATTTTAATTTCATTATTTATAAGGATATATAATATATTGAAATAAAATATATTTGGTGGTGTTACAC
ACAGTTGAAAGGCCCAGAAATAAAAATGAAAACAGGAAGAAAAGATAGCAAAGAAAGTTATGCAGCAGTGGTTGACAAATTAATCCCTAATCACAATGACTCAATGTCATTAGTTCTTTC
AACATTCCAATCAATTGGTATTGATACTGAAGGAACAGTTGCTCTATTAG
GTAAAATTTATTTATTTTATATTTAATTGCGATTATTTGTATTGATATTTTGTTAATTTTTCGTGTAGTG
ATGTATACGTAACGCCACGAAGACAAATTTTTTTTTCTTCTTTGAATTGGTAAATAGAATTTTGGTTTCACCGCTATATGAACTGTTAATGGCTCGTTTGGCTGGTAAGATTAATCACGA
TTACTTAAATAATTGGACTTTATTGAATGTTTGATGAATTCAATTACATTTTGTGTTGGCCATAGATTATGAAAATTATTATGATGGCTAATTGGTCGTTTGGTAAAACTTGCTTTAAAC
AGCTGATAAGCCCTTACATTTGATAAGTTGTTTTAAAAGCTGATAAGTTGTTACGTTTATTTTTAGAATTAATTTCTGAAGTGCTTGGACAATGAGCTTATAAACTATTTTTACTCATGT
TAAGATTTTAAATAAAAAGTTAGGGTAGATGTATTTAAAAAAAACTTATTTGCTCTCAATAAGCTTATTTTGTGATTTTTTTTACATCTTATTAAAAAAATTGTCGAACACTTTGGAGGA
GCTTATAAGCTCTTAAATATTTTATAAGTTCTTTGTAACAACTTATAAGCTTAAGCAAATACCCTCTAACTTTACCTTAGAAACTAAAGAAATAATAACTCTTTGATTCAACCATGAACT
ATTTCAGGTGCGCATTCAGTCGGACGAGTTCACTGCAGAAACATTGTGCAAAGAATATACCCGACGGTAGATCCATCTCTGGACCCACAATACGCAGATTACCTCAAGTTCCGTTGCCCT
TCACCGAACCCCGACCCAAAGGTTGTCGATTACGTGAGAAACGACCTCGAAACTCCGATGGAGCTAGACAACATGTACTACAAGAACCTCTTAAGCCACAAGGGATTATTGCTAATTGAT
TCGGAATTAGTTTCTAATCCAACAACTTATCCATTTGTGGTGAAAATGGCTGCTGATAATGCTTACTTTCATGATCAATTCTCGAGGGCTTTGCTCATTTTATCTGAGAATAATCCACTT
AGTGGTGATCAAGGAGATATTAGAAAGGATTGTCGATTTTTAAACCACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTCAACCATACTTTTATCGTTCTGTTATTACCGTTGCTCTTGCAGTTTTATTCTGTTAAAAGTGAACTGCAGTTAAATTACTACTCAAAGAGTTGCCCAAGAGCAGAAGAG
ATTATCAAAGAACAAGTCGCCATTTTATACCGCAAGCACGGAAACACCGCCGTTTCTTGGATCCGAAATCTCTTCCACGACTGCGTCGTTAAG
TCATGCGACGCATCGCTTTTATTGGAC
ACGGTAGTTGGAGTGACGTCGGAGAAAACGGCGGCGAGGAGTTTCGGGATGAGAAATTTCAAGTACATAGACACAATAAAAGATGCACTTGAGAAGGAGTGCCCCTTGACTGTTTCTTGT
GCTGATATTATTGCTCTTACTGCTAGAGATGGTGCAGCCCTG
TTGAAAGGCCCAGAAATAAAAATGAAAACAGGAAGAAAAGATAGCAAAGAAAGTTATGCAGCAGTGGTTGACAAATTA
ATCCCTAATCACAATGACTCAATGTCATTAGTTCTTTCAACATTCCAATCAATTGGTATTGATACTGAAGGAACAGTTGCTCTATTAG
GTGCGCATTCAGTCGGACGAGTTCACTGCAGA
AACATTGTGCAAAGAATATACCCGACGGTAGATCCATCTCTGGACCCACAATACGCAGATTACCTCAAGTTCCGTTGCCCTTCACCGAACCCCGACCCAAAGGTTGTCGATTACGTGAGA
AACGACCTCGAAACTCCGATGGAGCTAGACAACATGTACTACAAGAACCTCTTAAGCCACAAGGGATTATTGCTAATTGATTCGGAATTAGTTTCTAATCCAACAACTTATCCATTTGTG
GTGAAAATGGCTGCTGATAATGCTTACTTTCATGATCAATTCTCGAGGGCTTTGCTCATTTTATCTGAGAATAATCCACTTAGTGGTGATCAAGGAGATATTAGAAAGGATTGTCGATTT
TTAAACCACTAA

Retrieve as FASTA