Entry information : MguPrx46 (mgv1a010221m)
Entry ID 9215
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx46 (mgv1a010221m)
Name (synonym) MguPrx46 (mgv1a010221m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx46
start..stop
S start..stop
MguPrx47 629 0 1..318 1..318
MguPrx48 594 0 1..318 1..318
SbaPrx03 505 0 1..318 1..318
VvPrx35 445 7e-159 11..318 16..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2340302..2340514 213 N° 2 2340699..2340890 192 N° 3 2340995..2341160 166 N° 4 2341255..2341637 383
join(2340302..2340514,2340699..2340890,2340995..2341160,2341255..2341637)


exon

Literature and cross-references MguPrx46 (mgv1a010221m)
DNA ref. Phytozome 12:   scaffold_13 (2340302..2341637)
Protein sequence: MguPrx46 (mgv1a010221m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   33684.74 (31153.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.49 (8.40) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSTCVFSARLMFVLFLIGAANAQLSPNFYSTTCPNLLTIIRTAVNTAVTNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVTGFTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALSLGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFRNRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTVSPTTFNNDYYTNLVNLRGLLNSDQVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNCRLR

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTTCTACTTGTGTTTTTTCGGCTCGGTTAATGTTTGTTCTTTTTCTAATTGGAGCAGCTAATGCACAGTTATCTCCCAATTTCTATAGTACAACATGCCCTAATCTTCTTACC
ATTATTAGGACAGCTGTCAATACCGCTGTCACAAACGACCCTCGTATGGGCGCCTCTTTGCTTCGTCTCCATTTCCACGATTGCTTTGTGCAG
GTAATATCATTAATTAATTAATTAATT
TCATGATTTACTACACATGCATGCATGCGAATATGGGAGATGTTTTTATTCTTCATTCTTCCTTCAATTTATAAATCACATAATTGATATTTAGTAAATTTAGCGTTGTTAATTATATGA
TTATTGATATCTAAACTTTAAATATATATATAAACAGGGATGCGATGGATCAGTATTACTGGATGACGTAACAGGTTTCACGGGAGAAAAGACCGCTGCTCCGAACGCCAACTCACTGAG
AGGGTTCGATGTAATCGACACCATCAAAACCCAAGTCGAGGCTGCCTGCCCCGGCATCGTTTCATGCGCCGATATTCTCACCGTCGCTGCCCGTGACGGCACTGTTGCA
GTAAGTGATTA
ATGATTAATTAATTAATTTCATTAATTACACATGCATGTTTCAATTATTAATTAGTATAATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGCGAAGCGGTCCTAGTTGGGCGCTTTCA
CTCGGAAGGAGAGACTCAACCACCGCGAGTTTGACCGGAGCAAACGGTCAACTACCCGGACCCGGATCCAGTCTCAACAACCTTATTACTTCATTCTCCAACAAAGGTTTCACTACTCGG
GAAATGGTTGCCCTTTCTG
GNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAGTNNNNNNNNNNNNNNNNNNNNNNNNNNTAATTATTTTTGTAAATATTATAGGATCGCA
CACAATAGGATTGGCAAGGTGCAGTACATTCAGGAACAGAATCTACAACGCAGCCAACATAGATCCCGCCTTTGCCACCACAAGGAGGGCGAATTGTCCGCCAACCGGCGGAAACAACAA
CCTAGCGCCGCTCGACACCGTCAGCCCCACAACATTCAACAACGATTACTACACCAATTTGGTGAATCTGAGGGGTCTGCTCAATTCCGACCAGGTACTGTTCAACAATGGAACCACAGA
CGCGCAGGTGAGAGCGTACAGTACAAACTCCGCTTCTTTCTTCAACGACTTCGCCGCTGCTATGGTTAAGATGTCGAACCTCACCCCACTCACCGGCACCAATGGCCAAATCAGGAGAAA
CTGCAGACTTAGAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTTCTACTTGTGTTTTTTCGGCTCGGTTAATGTTTGTTCTTTTTCTAATTGGAGCAGCTAATGCACAGTTATCTCCCAATTTCTATAGTACAACATGCCCTAATCTTCTTACC
ATTATTAGGACAGCTGTCAATACCGCTGTCACAAACGACCCTCGTATGGGCGCCTCTTTGCTTCGTCTCCATTTCCACGATTGCTTTGTGCAG
GGATGCGATGGATCAGTATTACTGGAT
GACGTAACAGGTTTCACGGGAGAAAAGACCGCTGCTCCGAACGCCAACTCACTGAGAGGGTTCGATGTAATCGACACCATCAAAACCCAAGTCGAGGCTGCCTGCCCCGGCATCGTTTCA
TGCGCCGATATTCTCACCGTCGCTGCCCGTGACGGCACTGTTGCA
CGAAGCGGTCCTAGTTGGGCGCTTTCACTCGGAAGGAGAGACTCAACCACCGCGAGTTTGACCGGAGCAAACGGT
CAACTACCCGGACCCGGATCCAGTCTCAACAACCTTATTACTTCATTCTCCAACAAAGGTTTCACTACTCGGGAAATGGTTGCCCTTTCTG
GATCGCACACAATAGGATTGGCAAGGTGC
AGTACATTCAGGAACAGAATCTACAACGCAGCCAACATAGATCCCGCCTTTGCCACCACAAGGAGGGCGAATTGTCCGCCAACCGGCGGAAACAACAACCTAGCGCCGCTCGACACCGTC
AGCCCCACAACATTCAACAACGATTACTACACCAATTTGGTGAATCTGAGGGGTCTGCTCAATTCCGACCAGGTACTGTTCAACAATGGAACCACAGACGCGCAGGTGAGAGCGTACAGT
ACAAACTCCGCTTCTTTCTTCAACGACTTCGCCGCTGCTATGGTTAAGATGTCGAACCTCACCCCACTCACCGGCACCAATGGCCAAATCAGGAGAAACTGCAGACTTAGAAAC

Retrieve as FASTA