Entry information : MguPrx47 (mgv1a010225m)
Entry ID 9216
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx47 (mgv1a010225m)
Name (synonym) MguPrx47 (mgv1a010225m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx47
start..stop
S start..stop
MguPrx46 629 0 1..318 1..318
MguPrx48 588 0 1..318 1..318
SbaPrx03 503 0 8..318 8..318
VvPrx35 446 5e-159 11..318 16..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2335396..2335608 213 N° 2 2335020..2335211 192 N° 3 2334750..2334917 168 N° 4 2334272..2334652 381
complement(join(2334272..2334652,2334750..2334917,2335020..2335211,2335396..2335 608))


exon

Literature and cross-references MguPrx47 (mgv1a010225m)
DNA ref. Phytozome 12:   scaffold_13 (2335608..2334272)
Protein sequence: MguPrx47 (mgv1a010225m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   33709.79 (31180.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.57 (8.40) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSSYVFSARLMFVLVLIGAANAQLSPNFYSTTCPNLLTIIRTAVNTAVNNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVTGFTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALSLGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFRNRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTLSPTTFNNDYYTNLVNLRGLLNSDQVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNCRLRN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTTCTTCTTATGTTTTTTCGGCTCGGTTAATGTTTGTTCTTGTTCTAATTGGAGCAGCTAATGCACAGTTATCTCCCAATTTCTATAGTACAACATGCCCTAATCTTCTTACC
ATTATTAGGACAGCTGTCAATACTGCGGTGAACAACGACCCTCGTATGGGCGCCTCTTTGCTTCGTCTCCATTTCCACGATTGCTTTGTGCAG
GTAATATCATTAATTAATTAATTAATT
TCATGATTTACTACACATGCATGCATGCGAATATGGGAGATGTTTTTATTCTTCATTCTTCCTTCAATTTATAAATCACATAATTGATATTTAGTAAATTTAGCGTTGTTAATTATATGA
TTATTGATATCTAAACTTTAAATATATATATAAACAGGGATGCGATGGATCAGTATTATTGGATGACGTAACAGGTTTCACCGGAGAAAAGACTGCCGCTCCGAACGCCAACTCATTGAG
AGGGTTCGATGTCATCGACACCATCAAAACCCAAGTTGAGGCTGCCTGCCCGGGCATCGTTTCATGCGCCGATATTCTCACGGTTGCCGCCCGTGACGGCACTGTTGCA
GTAAGTGATTA
ATGATTAATTAATTAATTTCATTAATTACACATGCGTGTTTCAATTATTAATTAGTATAATGCNNNNNNNNNNNNNNNNNNNNNNNNNCAGCGAAGCGGTCCAAGCTGGGCGCTTTCACT
CGGAAGAAGAGACTCAACCACCGCGAGTTTGACCGGAGCAAACGGTCAACTACCCGGACCCGGATCAAGTCTCAACAACCTTATCACTTCATTCTCCAACAAAGGCTTCACTACTAGGGA
AATGGTTGCCCTTTCTGGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGTCGC
ACACAATAGGATTGGCGAGGTGCAGTACATTCAGGAACAGAATCTACAACGCAGCCAACATAGATCCCGCCTTTGCCACCACAAGGAGGGCGAATTGTCCGCCAACCGGCGGAAACAACA
ACCTAGCGCCGCTCGACACCCTCAGCCCCACCACATTCAACAACGATTACTACACCAATTTGGTGAATCTGAGGGGTCTCCTCAATTCCGACCAAGTACTGTTCAACAATGGAACCACAG
ACGCGCAGGTGAGAGCGTACAGTACAAACTCGGCTTCTTTCTTCAACGACTTCGCCGCTGCTATGGTTAAGATGTCCAACCTCACCCCACTCACCGGCACCAACGGCCAAATCAGGAGAA
ACTGCAGGCTTAGAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTTCTTCTTATGTTTTTTCGGCTCGGTTAATGTTTGTTCTTGTTCTAATTGGAGCAGCTAATGCACAGTTATCTCCCAATTTCTATAGTACAACATGCCCTAATCTTCTTACC
ATTATTAGGACAGCTGTCAATACTGCGGTGAACAACGACCCTCGTATGGGCGCCTCTTTGCTTCGTCTCCATTTCCACGATTGCTTTGTGCAG
GGATGCGATGGATCAGTATTATTGGAT
GACGTAACAGGTTTCACCGGAGAAAAGACTGCCGCTCCGAACGCCAACTCATTGAGAGGGTTCGATGTCATCGACACCATCAAAACCCAAGTTGAGGCTGCCTGCCCGGGCATCGTTTCA
TGCGCCGATATTCTCACGGTTGCCGCCCGTGACGGCACTGTTGCA
CGAAGCGGTCCAAGCTGGGCGCTTTCACTCGGAAGAAGAGACTCAACCACCGCGAGTTTGACCGGAGCAAACGGT
CAACTACCCGGACCCGGATCAAGTCTCAACAACCTTATCACTTCATTCTCCAACAAAGGCTTCACTACTAGGGAAATGGTTGCCCTTTCTGGN
TCGCACACAATAGGATTGGCGAGGTGC
AGTACATTCAGGAACAGAATCTACAACGCAGCCAACATAGATCCCGCCTTTGCCACCACAAGGAGGGCGAATTGTCCGCCAACCGGCGGAAACAACAACCTAGCGCCGCTCGACACCCTC
AGCCCCACCACATTCAACAACGATTACTACACCAATTTGGTGAATCTGAGGGGTCTCCTCAATTCCGACCAAGTACTGTTCAACAATGGAACCACAGACGCGCAGGTGAGAGCGTACAGT
ACAAACTCGGCTTCTTTCTTCAACGACTTCGCCGCTGCTATGGTTAAGATGTCCAACCTCACCCCACTCACCGGCACCAACGGCCAAATCAGGAGAAACTGCAGGCTTAGAAAC

Retrieve as FASTA