Entry information : MguPrx50 (Migut.J01604.1 / mgv1a010343m)
Entry ID 9219
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2013-12-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-12-23 (Christophe Dunand)
Peroxidase information: MguPrx50 (Migut.J01604.1 / mgv1a010343m)
Name (synonym) MguPrx50 (Migut.J01604.1 / mgv1a010343m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx50
start..stop
S start..stop
SaPrx51 479 5e-172 1..323 1..327
PpePrx32 445 1e-158 22..323 22..318
MePrx102 442 1e-157 9..324 8..319
CpapPrx12 435 4e-153 21..321 9..308
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17639584..17639784 201 N° 2 17638340..17639119 780  
join(complement(17638340..17639119,17639584..17639784))


exon

Literature and cross-references MguPrx50 (Migut.J01604.1 / mgv1a010343m)
DNA ref. Phytozome 11:   scaffold_10 (17639784..17638340)
EST ref. GenBank:   GR044654.1 [5' end]
Protein sequence: MguPrx50 (Migut.J01604.1 / mgv1a010343m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (306)
PWM (Da):   %s   35031.98 (32967.8) Transmb domain:   %s   i5-22o
PI (pH):   %s   9.37 (9.35) Peptide Signal:   %s   cut: 21 range:21-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKTAVLVVVFLSIICFASAQLKLGFYSTTCPKAESIIQGVVKQRFSKDRSITAALLRMHFHDCFVRGCDASILIDSTRTTSSEKDAGPNLTVRGNDLIDAAKKAVEAVCPSTVSCADIITLATRDSVALAGGPKYTLSTGRRDGLVSDANEVDLPGPSQSVSDAFATFRAKGMTMNDMVTLLGAHTVGVAHCGFFQDRLSNFQGTGKPDPTMEPALAARLLKTCGTQFRPLSSDPKVFLDQGTSFAFDNQFYNQTLFKRGIMQIDQELALDRLSAPIVSGFAKNGVAFQQSFANAMIKMSKIQVLVGKAGEIRKNCRVFNPKKKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome: two extra intron due to undetermined residues. PS completed from ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAAACAGCAGTATTAGTAGTTGTTTTCCTCAGCATTATTTGTTTTGCTTCTGCTCAACTAAAATTAGGGTTTTACAGTACCACGTGTCCGAAAGCTGAATCGATAATCCAAGGA
GTTGTGAAACAAAGATTTAGTAAAGATCGTTCCATTACCGCAGCTTTGCTTCGAATGCATTTCCACGATTGCTTCGTTCGG
GTACGTTTAAACGGAAAAAAAAAAAAAAAAACCGTTACC
TATTTTAATATGCTATTACATTATATATGTAATATGTTGCAATAAAATTAGTTATGTATCTTAATTCAGGGATGGTTTGAATTTTTGAAACCCTAAATCCATTATACAAATTTTTCTTAG
CTTTTTTTTTTTTTTTTTTATTGTTTTTTAATTTTTTTTTTTTGAATTTTTTTTGGGTTTTCCATAGTTAAATTTTGTATTTTAATTTGAATATGACTATATTGCCAATCATATAGACAA
AAAGATATGTTTGCTTATATTATTGTGAAGAAGAAACACATACACTTCCCCACGTTTTAATTTAAAAAATAAACAAAAAACAAAATAATTCTACTCTATTCTTTGTATTATTATTTTGGC
ATAACCTCCAAATATTCTTATTCTTGTACACTAATTAATACAATCAATATACATATCAAATGAAGGGTTGTGATGCATCAATACTCATAGACTCCACAAGAACCACATCCTCGGAAAAGG
ACGCGGGCCCGAACCTAACCGTCCGGGGCAACGACCTAATCGACGCCGCCAAGAAAGCCGTAGAAGCCGTATGCCCCTCCACCGTCTCATGCGCCGACATAATCACATTAGCCACCCGAG
ACTCGGTGGCTCTGGCCGGTGGGCCCAAGTACACCCTGTCCACCGGCCGACGTGACGGGCTCGTCTCCGACGCGAACGAGGTCGATCTACCGGGACCCTCGCAGTCGGTCTCGGACGCCT
TCGCCACTTTCAGGGCGAAAGGGATGACCATGAACGACATGGTCACCCTACTGGGGGCCCACACAGTGGGCGTGGCCCACTGTGGGTTTTTCCAGGACAGGCTTTCCAATTTCCAGGGAA
CTGGAAAGCCTGACCCCACCATGGAACCCGCATTGGCCGCTAGGCTTCTGAAGACTTGTGGGACCCAGTTTAGGCCGTTGAGCAGCGATCCGAAGGTTTTCCTCGACCAGGGAACTTCGT
TCGCGTTCGATAATCAATTCTACAATCAGACTTTGTTCAAGAGAGGGATCATGCAGATTGATCAGGAGCTGGCATTGGATAGGTTAAGCGCACCAATCGTATCGGGTTTCGCGAAGAACG
GCGTTGCGTTTCAACAGAGCTTTGCGAATGCTATGATCAAGATGAGTAAGATACAAGTTCTTGTGGGGAAAGCTGGAGAAATTAGGAAGAATTGCAGGGTTTTTAATCCTAAGAAAAAAG
CTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAAACAGCAGTATTAGTAGTTGTTTTCCTCAGCATTATTTGTTTTGCTTCTGCTCAACTAAAATTAGGGTTTTACAGTACCACGTGTCCGAAAGCTGAATCGATAATCCAAGGA
GTTGTGAAACAAAGATTTAGTAAAGATCGTTCCATTACCGCAGCTTTGCTTCGAATGCATTTCCACGATTGCTTCGTTCGG
GGTTGTGATGCATCAATACTCATAGACTCCACAAGAACC
ACATCCTCGGAAAAGGACGCGGGCCCGAACCTAACCGTCCGGGGCAACGACCTAATCGACGCCGCCAAGAAAGCCGTAGAAGCCGTATGCCCCTCCACCGTCTCATGCGCCGACATAATC
ACATTAGCCACCCGAGACTCGGTGGCTCTGGCCGGTGGGCCCAAGTACACCCTGTCCACCGGCCGACGTGACGGGCTCGTCTCCGACGCGAACGAGGTCGATCTACCGGGACCCTCGCAG
TCGGTCTCGGACGCCTTCGCCACTTTCAGGGCGAAAGGGATGACCATGAACGACATGGTCACCCTACTGGGGGCCCACACAGTGGGCGTGGCCCACTGTGGGTTTTTCCAGGACAGGCTT
TCCAATTTCCAGGGAACTGGAAAGCCTGACCCCACCATGGAACCCGCATTGGCCGCTAGGCTTCTGAAGACTTGTGGGACCCAGTTTAGGCCGTTGAGCAGCGATCCGAAGGTTTTCCTC
GACCAGGGAACTTCGTTCGCGTTCGATAATCAATTCTACAATCAGACTTTGTTCAAGAGAGGGATCATGCAGATTGATCAGGAGCTGGCATTGGATAGGTTAAGCGCACCAATCGTATCG
GGTTTCGCGAAGAACGGCGTTGCGTTTCAACAGAGCTTTGCGAATGCTATGATCAAGATGAGTAAGATACAAGTTCTTGTGGGGAAAGCTGGAGAAATTAGGAAGAATTGCAGGGTTTTT
AATCCTAAGAAAAAAGCTTGA

Retrieve as FASTA