Entry information : MguPrx56 (mgv1a010695m)
Entry ID 9224
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx56 (mgv1a010695m)
Name (synonym) MguPrx56 (mgv1a010695m)
Class Class III peroxidase     [Orthogroup: Prx028]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx56
start..stop
S start..stop
CroPrx09 504 0 4..305 15..321
InPrx04 503 0 10..304 28..323
NtPrx07-1A 499 2e-180 10..305 32..328
NtPrx07-1B 497 1e-179 4..305 15..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4290954..4291121 168 N° 2 4291280..4291468 189 N° 3 4291556..4291718 163 N° 4 4291786..4292183 398
join(4290954..4291121,4291280..4291468,4291556..4291718,4291786..4292183)


exon

Literature and cross-references MguPrx56 (mgv1a010695m)
DNA ref. Phytozome 12:   scaffold_3 (4290954..4292183)
Protein sequence: MguPrx56 (mgv1a010695m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305
PWM (Da):   %s   33535.25  
PI (pH):   %s   6.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNMMVKSGYGLSMNYYMMACPFADMVIRNTVNKALQSDPTLAAALVRMHFHDCFVEGCDGSVLIDSTKDNTAEKDSPANLSLRGYEIIDAAKDALERQCPGVVSCADILAMAARDAVFFAGGPFYDLPKGRKDGRRSKIEDTINLPPPTLNSSELITMFGKRGFTAQEMVVLSGGHTLGMARCSSFKSRLTNFDSTHDVDPNLDTQFARTLLKTCSGGDKAEQPFDSSRNSFDNDYFNALQRKAGVLVSDQTLFASAMTRGMVNAYATNQAMFFFDFQRAFVKMGLMDVKEGSKGEVRNTCRIIN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short 5' end is missing due to 'NNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATGATGGTGAAGAGTGGATATGGTCTGAGCATGAATTACTACATGATGGCTTGTCCATTTGCTGACATGGTTATTAGGAACACTGTTAATAAGGCTCTCCAATCTGATCCCACT
CTTGCTGCTGCTCTTGTCAGGATGCATTTCCATGACTGCTTTGTTGAG
GTCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTGCTAATTATGTGTGTATTATGTAAATAAAAACGTATAGGGGTGTGATGGATCTGTACTGATAGACTCAACTA
AAGATAATACGGCGGAAAAGGATTCACCGGCAAATTTAAGCTTGCGTGGCTATGAAATAATCGATGCTGCCAAGGATGCATTGGAGAGGCAGTGCCCCGGGGTTGTTTCGTGTGCTGATA
TTCTTGCAATGGCCGCTAGAGACGCTGTTTTCTTC
GTAAGAAATAGTACTTTTTTCTCAGATTAATCATTGATCTTTTATTAACAATATTAATATTTGATGATGATGCATGCATGTGTTT
AGGCTGGTGGTCCATTCTATGACTTACCTAAAGGAAGAAAAGATGGAAGAAGATCGAAGATCGAAGACACAATCAATCTTCCTCCACCAACCTTAAACAGCTCCGAACTCATCACCATGT
TTGGCAAACGTGGCTTCACTGCTCAAGAAATGGTCGTTTTATCTG
GTAATTATTATTATTAACACATACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAGGTGGGCAC
ACACTGGGAATGGCGAGATGCTCGTCGTTCAAAAGCCGTCTGACAAACTTCGACTCGACGCACGATGTGGACCCCAACTTGGACACGCAGTTTGCAAGAACACTGTTGAAGACATGCAGC
GGAGGTGACAAAGCAGAGCAGCCATTCGATTCGTCGAGAAACAGTTTCGACAATGATTACTTCAACGCACTACAGAGGAAAGCAGGTGTTCTTGTTTCAGACCAGACACTGTTTGCAAGT
GCGATGACTAGAGGGATGGTGAATGCATACGCAACAAACCAGGCCATGTTCTTCTTCGATTTTCAGCGCGCTTTTGTGAAAATGGGGTTGATGGATGTTAAAGAAGGTTCCAAGGGTGAA
GTTAGAAACACTTGTCGGATCATTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATGATGGTGAAGAGTGGATATGGTCTGAGCATGAATTACTACATGATGGCTTGTCCATTTGCTGACATGGTTATTAGGAACACTGTTAATAAGGCTCTCCAATCTGATCCCACT
CTTGCTGCTGCTCTTGTCAGGATGCATTTCCATGACTGCTTTGTTGAG
GGGTGTGATGGATCTGTACTGATAGACTCAACTAAAGATAATACGGCGGAAAAGGATTCACCGGCAAATTTA
AGCTTGCGTGGCTATGAAATAATCGATGCTGCCAAGGATGCATTGGAGAGGCAGTGCCCCGGGGTTGTTTCGTGTGCTGATATTCTTGCAATGGCCGCTAGAGACGCTGTTTTCTTC
GCT
GGTGGTCCATTCTATGACTTACCTAAAGGAAGAAAAGATGGAAGAAGATCGAAGATCGAAGACACAATCAATCTTCCTCCACCAACCTTAAACAGCTCCGAACTCATCACCATGTTTGGC
AAACGTGGCTTCACTGCTCAAGAAATGGTCGTTTTATCTG
GTGGGCACACACTGGGAATGGCGAGATGCTCGTCGTTCAAAAGCCGTCTGACAAACTTCGACTCGACGCACGATGTGGAC
CCCAACTTGGACACGCAGTTTGCAAGAACACTGTTGAAGACATGCAGCGGAGGTGACAAAGCAGAGCAGCCATTCGATTCGTCGAGAAACAGTTTCGACAATGATTACTTCAACGCACTA
CAGAGGAAAGCAGGTGTTCTTGTTTCAGACCAGACACTGTTTGCAAGTGCGATGACTAGAGGGATGGTGAATGCATACGCAACAAACCAGGCCATGTTCTTCTTCGATTTTCAGCGCGCT
TTTGTGAAAATGGGGTTGATGGATGTTAAAGAAGGTTCCAAGGGTGAAGTTAGAAACACTTGTCGGATCATTAACTGA

Retrieve as FASTA