Entry information : MguPrx64 (mgv1a013189m)
Entry ID 9225
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx64 (mgv1a013189m)
Name (synonym) MguPrx64 (mgv1a013189m)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx64
start..stop
S start..stop
MguPrx41 637 0 1..324 1..324
MguPrx43 466 4e-167 11..324 13..323
MguPrx85 464 2e-166 7..324 5..320
SbaPrx02 459 2e-164 25..324 26..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 850860..851276 417 N° 2 850567..850736 170 N° 3 850065..850449 385  
complement(join(850065..850449,850567..850736,850860..851276))


exon

Literature and cross-references MguPrx64 (mgv1a013189m)
DNA ref. Phytozome 12:   scaffold_32 (851276..850065)
Protein sequence: MguPrx64 (mgv1a013189m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   35060.73 (32220.3)  
PI (pH):   %s   8.21 (8.40) Peptide Signal:   %s   cut: 28 range:28-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYFATIFATSALALMLVLSQVPASEAQLSPPTFYDATCPNALATIRTSIRQAVSRERRMAGSLIRLHFHDCFVQGCDASILLDETPTIRSEKTAFPNVNSVRGYEVIDAAKTLVERICPGVVSCADILTLAARDASVAVGGPTWNVRLGRRDSTTANRDQANRDLPGPDSTLQRLIDSFGIKNNLTPRDMVALSGTHTRS*PQCSSFRTRIYSNGTNIDPGFATTRRRTCPQTGGDGNLAPLDLVTPNSFDHNYFRNLVQRRELLQSDQVLLSGGSTDSIVTEYSTTPRTFAADFATAMIKMSEIEPVTGQSGIIRRICTAI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (3' end is missing; Stop in frame due to bad sequencing maybe).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTATTTCGCCACAATTTTCGCCACATCAGCACTAGCACTCATGCTCGTGCTCTCGCAAGTGCCGGCATCAGAAGCGCAACTGTCTCCTCCGACGTTCTACGACGCAACATGCCCT
AACGCGCTCGCCACAATCCGAACATCAATCCGACAAGCAGTGTCGCGTGAGAGGCGAATGGCCGGCTCACTCATCCGCCTCCACTTCCACGACTGCTTCGTCCAGGGTTGCGACGCTTCG
ATCCTATTGGACGAGACCCCCACCATCCGATCCGAGAAAACCGCATTTCCGAACGTCAATTCCGTCAGAGGCTACGAAGTGATCGACGCCGCCAAAACCCTAGTCGAGCGCATATGCCCT
GGTGTCGTCTCTTGCGCCGATATACTAACCCTAGCTGCCCGTGATGCCTCCGTCGCT
GTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAGTTCGTTATT
GCATTCAGAACGTATTACCTCCATATTTAATTTAATTTAATGTGATAATGAAAATTATAGGTTGGTGGTCCGACGTGGAACGTGAGATTGGGGAGAAGGGATTCAACCACGGCGAACCGT
GACCAGGCGAACAGGGATCTTCCGGGGCCCGATTCTACTCTCCAAAGACTTATCGATTCTTTCGGTATCAAAAATAATCTCACCCCTAGAGACATGGTTGCTTTATCAGG
TAATTGATTT
CCCATGATCAAATTAACAATTCTCTATACTGCATATATATAATCCGAAAAAATGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCTATGCAGGAGCACACACACTAGG
TCTTAGCCCCAATGCTCCTCGTTCCGCACGAGAATTTACAGCAACGGAACGAACATCGACCCAGGATTCGCTACCACTAGAAGACGCACTTGCCCGCAAACCGGAGGTGACGGAAATTTG
GCGCCCCTAGATTTGGTGACGCCTAATTCATTCGACCACAACTACTTTAGGAACTTGGTGCAGAGGAGGGAGCTTCTTCAGTCGGATCAAGTGCTTCTAAGCGGAGGATCGACAGACAGT
ATAGTGACGGAATACAGTACTACTCCGAGAACTTTCGCAGCAGATTTCGCCACCGCAATGATTAAGATGAGTGAGATTGAGCCGGTTACCGGACAAAGTGGGATCATACGAAGGATTTGT
ACCGCCATCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTATTTCGCCACAATTTTCGCCACATCAGCACTAGCACTCATGCTCGTGCTCTCGCAAGTGCCGGCATCAGAAGCGCAACTGTCTCCTCCGACGTTCTACGACGCAACATGCCCT
AACGCGCTCGCCACAATCCGAACATCAATCCGACAAGCAGTGTCGCGTGAGAGGCGAATGGCCGGCTCACTCATCCGCCTCCACTTCCACGACTGCTTCGTCCAGGGTTGCGACGCTTCG
ATCCTATTGGACGAGACCCCCACCATCCGATCCGAGAAAACCGCATTTCCGAACGTCAATTCCGTCAGAGGCTACGAAGTGATCGACGCCGCCAAAACCCTAGTCGAGCGCATATGCCCT
GGTGTCGTCTCTTGCGCCGATATACTAACCCTAGCTGCCCGTGATGCCTCCGTCGCT
GTTGGTGGTCCGACGTGGAACGTGAGATTGGGGAGAAGGGATTCAACCACGGCGAACCGTGAC
CAGGCGAACAGGGATCTTCCGGGGCCCGATTCTACTCTCCAAAGACTTATCGATTCTTTCGGTATCAAAAATAATCTCACCCCTAGAGACATGGTTGCTTTATCAGG
CACACACACTAGG
TCTTAGCCCCAATGCTCCTCGTTCCGCACGAGAATTTACAGCAACGGAACGAACATCGACCCAGGATTCGCTACCACTAGAAGACGCACTTGCCCGCAAACCGGAGGTGACGGAAATTTG
GCGCCCCTAGATTTGGTGACGCCTAATTCATTCGACCACAACTACTTTAGGAACTTGGTGCAGAGGAGGGAGCTTCTTCAGTCGGATCAAGTGCTTCTAAGCGGAGGATCGACAGACAGT
ATAGTGACGGAATACAGTACTACTCCGAGAACTTTCGCAGCAGATTTCGCCACCGCAATGATTAAGATGAGTGAGATTGAGCCGGTTACCGGACAAAGTGGGATCATACGAAGGATTTGT
ACCGCCATCAAC

Retrieve as FASTA