Entry information : MguPrx66 (Migut.L00200.1 / mgv1a014486m)
Entry ID 9227
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2013-12-23 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-12-23 (Christophe Dunand)
Peroxidase information: MguPrx66 (Migut.L00200.1 / mgv1a014486m)
Name (synonym) MguPrx66 (Migut.L00200.1 / mgv1a014486m)
Class Class III peroxidase     [Orthogroup: Prx015]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx66
start..stop
S start..stop
SinPrx01 395 3e-140 1..243 1..240
MguPrx16 393 3e-139 1..243 6..247
NtPrx22-1B 377 5e-133 1..243 1..242
MguPrx103 375 1e-132 27..243 17..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 154846..155070 225 N° 2 154521..154721 201 N° 3 154307..154439 133 N° 4 154269..154273 5
complement(join(154269..154273,154307..154439,154521..154721,154846..155070))


exon

Literature and cross-references MguPrx66 (Migut.L00200.1 / mgv1a014486m)
DNA ref. Phytozome 12:   scaffold_12 (1515357..1516307)
Protein sequence: MguPrx66 (Migut.L00200.1 / mgv1a014486m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   243 (215)
PWM (Da):   %s   25688.07 (22801.5)  
PI (pH):   %s   8.4 (7.99) Peptide Signal:   %s   cut: 29 range:29-243
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRVNFLTSLILSISVGVILFSGRPASAQLRQNFYSNTCPDVESIVRRAVSAKVSQTFVTIPATIRLFFHDCFVSGCDASVIVASTGGNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPRCKNKVSCADILALATRDVIVLAGGPTYPVELGRLDGLSSTSASVNGNLPKANFNLNQLNSMFASRGLTQADMIALSACHTLGFSHCTQITNRLYNFSxPRTPVDPTLTRQYATQLQGMCPRN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to 'NNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGGTTAATTTTCTGACGAGTCTAATATTATCAATTTCCGTGGGTGTTATTCTGTTCTCCGGCCGCCCGGCATCGGCTCAGCTCCGGCAGAACTTCTATTCGAACACCTGCCCC
GACGTGGAAAGCATCGTAAGAAGAGCCGTCTCGGCAAAAGTCAGCCAAACGTTCGTTACTATTCCGGCCACCATTCGTCTCTTTTTCCACGATTGTTTTGTTTCG
GTACGAGTAATTAAT
TAGTTACTACCATTAATAAATTAATTAATTACGATCATAATTGTTTCTTGTTGTACCTCGTGCTTTCTGATTTGTACATAAATTAAATTTGTTTTTTTTTTCTTGGTAGGGGTGTGACGC
GTCGGTGATAGTAGCGTCGACGGGGGGAAACACGGCGGAGAAGGACCACCCGGACAATTTGTCGCTCGCCGGAGATGGGTTCGACACCGTGATCAAAGCCAAAGCCGCCGTTGATGCCGT
CCCACGTTGTAAGAACAAGGTTTCTTGTGCCGATATTCTTGCATTGGCTACTCGTGACGTCATTGTCCTG
GTTTGTACTTTCTCTCTCTACACTCTCTCTCTCTCTAGACTCTCTCTCTC
TCTCTCTCTCTCTAAGTTCATGAATTAACAGGCTGGTGGGCCCACGTATCCGGTGGAATTGGGGCGATTGGATGGATTGAGCTCCACGTCAGCAAGTGTAAATGGGAATTTGCCCAAGGC
AAATTTCAACTTGAATCAGCTTAATTCCATGTTTGCTTCTAGAG
GTTTAACCCAGGCTGATATGATTGCTCTCTCAGGTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGGTTAATTTTCTGACGAGTCTAATATTATCAATTTCCGTGGGTGTTATTCTGTTCTCCGGCCGCCCGGCATCGGCTCAGCTCCGGCAGAACTTCTATTCGAACACCTGCCCC
GACGTGGAAAGCATCGTAAGAAGAGCCGTCTCGGCAAAAGTCAGCCAAACGTTCGTTACTATTCCGGCCACCATTCGTCTCTTTTTCCACGATTGTTTTGTTTCG
GGGTGTGACGCGTCG
GTGATAGTAGCGTCGACGGGGGGAAACACGGCGGAGAAGGACCACCCGGACAATTTGTCGCTCGCCGGAGATGGGTTCGACACCGTGATCAAAGCCAAAGCCGCCGTTGATGCCGTCCCA
CGTTGTAAGAACAAGGTTTCTTGTGCCGATATTCTTGCATTGGCTACTCGTGACGTCATTGTCCTG
GCTGGTGGGCCCACGTATCCGGTGGAATTGGGGCGATTGGATGGATTGAGCTCC
ACGTCAGCAAGTGTAAATGGGAATTTGCCCAAGGCAAATTTCAACTTGAATCAGCTTAATTCCATGTTTGCTTCTAGAG
GTAAT

Retrieve as FASTA