Entry information : MguPrx71 (mgv1a018175m)
Entry ID 9231
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx71 (mgv1a018175m)
Name (synonym) MguPrx71 (mgv1a018175m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx71
start..stop
S start..stop
RcPrx52 450 3e-161 8..309 22..317
GrPrx38 450 4e-161 1..309 22..323
CclPrx113 449 2e-160 8..309 24..318
GmPrx249 449 2e-160 7..309 24..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 868186..868350 165 N° 2 868467..868658 192 N° 3 868747..868912 166 N° 4 869497..869903 407
join(868186..868350,868467..868658,868747..868912,869497..869903)


exon

Literature and cross-references MguPrx71 (mgv1a018175m)
DNA ref. Phytozome 12:   scaffold_1 (868186..869903)
Protein sequence: MguPrx71 (mgv1a018175m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310
PWM (Da):   %s   32633.27  
PI (pH):   %s   6.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILIATSAQLSANHYSTSCPKALTTIKTTVLKTLLKDRRMGASLLRLHFHDCFVNGCDASVLLDDTSSMIGEKTAAPNNNSLRGFEVIDSIKSQLETICPGVVSCADILAVSARDSVVAVGGPSWGVQLGRRDSTTASIDSANTDIPSPTLDLPELISAFSNKGFTPKEMVALSGAHTIGQARCVVFRERIYNNETNDNIPASFATSLKSNCPLTGGDDNLSPLDATSSLSFDTAYFKNLVSNKGLLHSDQQLFGGGGATTSTDSLVSGYANNPPAFFSDFASAMIKMGNLSPLTGTNGQIRSNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTGATTGCCACGTCGGCGCAGTTGTCGGCGAACCACTACTCTACGTCTTGCCCGAAAGCTCTTACCACCATCAAAACAACTGTCTTGAAGACCCTTCTCAAGGACCGTCGTATG
GGAGCGTCTCTGCTTCGCCTTCATTTCCACGATTGCTTCGTCAAT
GTATACACTCTCTCTCTCTAAAACACATTGATAACTAAAGCATCAAATNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAACAGGGGTGTGATGCATCAGTTCTGCTAGATGACACTTCAAGTATGATAGGAGAGAAAACAGCAGCTCCGAATAACAACTCGT
TGAGGGGTTTCGAAGTGATCGATTCCATTAAGTCCCAACTCGAAACCATCTGCCCCGGAGTTGTTTCTTGCGCGGATATCCTAGCTGTTTCTGCCCGCGATTCCGTTGTTGCC
GTAAGCT
GCCGTTAATTAATTTAATTAACTACTACTTTTAATAAAATTAGCCCAATTAATAAATTTGCTGCACTGATTAATTAATCAGGTAGGTGGACCTTCATGGGGTGTTCAGCTGGGAAGACGG
GACTCGACTACAGCGAGTATTGATTCCGCAAACACGGATATTCCGTCGCCGACGCTCGATCTGCCCGAACTTATTTCCGCCTTCTCAAACAAAGGCTTTACACCAAAAGAAATGGTTGCA
CTTTCAG
GTATATAATAACAAAAGATCCCAAATAATAACAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGTTTCTTAAATTTAAATATGGAACAGGTGCTCACA
CAATAGGGCAAGCGAGATGCGTCGTGTTTCGCGAGCGCATCTACAACAACGAAACCAACGACAACATACCGGCCTCGTTCGCCACGTCACTCAAATCAAACTGTCCACTCACCGGCGGCG
ACGACAATCTCTCCCCGCTCGACGCCACGTCATCTCTCTCGTTCGACACCGCGTATTTCAAGAATCTAGTCAGCAACAAAGGCCTACTGCACTCCGACCAGCAGCTCTTCGGCGGTGGTG
GTGCTACTACTAGTACAGATTCTCTGGTGAGCGGTTACGCAAATAATCCACCGGCATTCTTCTCCGATTTTGCAAGTGCCATGATCAAGATGGGGAACCTCAGCCCACTTACAGGAACCA
ACGGTCAGATCAGAAGCAACTGCAGAAAGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTGATTGCCACGTCGGCGCAGTTGTCGGCGAACCACTACTCTACGTCTTGCCCGAAAGCTCTTACCACCATCAAAACAACTGTCTTGAAGACCCTTCTCAAGGACCGTCGTATG
GGAGCGTCTCTGCTTCGCCTTCATTTCCACGATTGCTTCGTCAAT
GGGTGTGATGCATCAGTTCTGCTAGATGACACTTCAAGTATGATAGGAGAGAAAACAGCAGCTCCGAATAACAAC
TCGTTGAGGGGTTTCGAAGTGATCGATTCCATTAAGTCCCAACTCGAAACCATCTGCCCCGGAGTTGTTTCTTGCGCGGATATCCTAGCTGTTTCTGCCCGCGATTCCGTTGTTGCC
GTA
GGTGGACCTTCATGGGGTGTTCAGCTGGGAAGACGGGACTCGACTACAGCGAGTATTGATTCCGCAAACACGGATATTCCGTCGCCGACGCTCGATCTGCCCGAACTTATTTCCGCCTTC
TCAAACAAAGGCTTTACACCAAAAGAAATGGTTGCACTTTCAG
GTGCTCACACAATAGGGCAAGCGAGATGCGTCGTGTTTCGCGAGCGCATCTACAACAACGAAACCAACGACAACATA
CCGGCCTCGTTCGCCACGTCACTCAAATCAAACTGTCCACTCACCGGCGGCGACGACAATCTCTCCCCGCTCGACGCCACGTCATCTCTCTCGTTCGACACCGCGTATTTCAAGAATCTA
GTCAGCAACAAAGGCCTACTGCACTCCGACCAGCAGCTCTTCGGCGGTGGTGGTGCTACTACTAGTACAGATTCTCTGGTGAGCGGTTACGCAAATAATCCACCGGCATTCTTCTCCGAT
TTTGCAAGTGCCATGATCAAGATGGGGAACCTCAGCCCACTTACAGGAACCAACGGTCAGATCAGAAGCAACTGCAGAAAGATTAATTAA

Retrieve as FASTA