Entry information : MguPrx73 (mgv1a018276m)
Entry ID 9233
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx73 (mgv1a018276m)
Name (synonym) MguPrx73 (mgv1a018276m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx73
start..stop
S start..stop
MguPrx101 578 0 4..314 1..324
StPrx20 395 4e-139 1..316 1..324
PpePrx78 389 1e-136 8..316 7..324
PpePrx73 386 1e-135 2..316 3..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 795252..795470 219 N° 2 794835..794930 96 N° 3 794738..794794 57 N° 4 794446..794611 166
N° 5 793176..793588 413  
complement(join(793176..793588,794446..794611,794738..794794,794835..794930,7952 52..795470))


exon

Literature and cross-references MguPrx73 (mgv1a018276m)
DNA ref. Phytozome 12:   scaffold_92 (795470..793176)
Protein sequence: MguPrx73 (mgv1a018276m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (290)
PWM (Da):   %s   33809.92 (30963.4)  
PI (pH):   %s   4.96 (4.72) Peptide Signal:   %s   cut: 27 range:27-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVLRVPIATFLVLIFVVGFGKGCNAQLSTTFYATTCPNISSVVLNVIEQAQRVDVRSAPKLIRLHFHDCFVNGCDGSLLLDNADGILSEKDAFPNAGSVDGFSLGGVSCADILAIASQISVNLVGGPSYLVPLGRRDGRTANRAGANTELPSPLANLNELKSNFSAKGLDSTDLVALSGAHTFGRAKCNTFSHRLYNFANSGGPDQTIEPTYLERLRQTCPQNGAPTTLENLDQSTPDVFDNEYFENLQSGKGLLQTDQLLFSSTGADTVAVVNRFGDSETEFFDAFVRSMIKMGNIGTLTGTQGEIRADCKRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGTGTTGAGAGTGCCAATAGCAACTTTTCTCGTGCTGATATTCGTAGTTGGGTTCGGAAAAGGATGTAACGCTCAGTTGAGCACCACATTCTACGCTACCACGTGCCCTAATATA
TCGAGCGTGGTTCTTAATGTCATCGAACAGGCTCAACGGGTTGATGTTCGGTCTGCCCCCAAACTTATTCGCCTTCACTTCCATGATTGTTTCGTCAAT
GTAAATNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTGTGTTAAGTACTAATTTGTTTGTGTTCATTCGTTAGGGCTGCGATGGCTCGCTTTTGCTAGACAATGCAGACGGCATACTCAGCGAAAAAGATGCG
TTCCCGAACGCTGGTTCTGTCGACGGATTCAGTTTA
GTAGATACATAAAAACAGCCTTGTGAGAGTGTGTGCCCAGGGGGGGGTCTCGTGTGCAGATATTTTGGCAATCGCTTCTCAAAT
TTCAGTTAACTTG
GTAAGTACATACAAATTAATTAATTAATCTTTGTTTCATGCACATAATTACTTATAAATTAGCAACTATTAATTGTAATTTTCAAGTTAATTAATTTAAAATATGGT
GTTATAATGAATTAATTAGGTAGGGGGGCCATCATATTTAGTACCACTAGGAAGAAGGGATGGAAGAACAGCAAATAGAGCAGGGGCAAATACGGAACTTCCAAGCCCTTTGGCGAACCT
TAACGAACTTAAATCCAATTTCAGCGCCAAGGGTCTCGACTCTACTGACTTGGTCGCTCTATCAG
GTATACTTAGGCCTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATATTACAAGATGAATATTAATCATGACAAAACACAAATCTAAATTCAAGATTTTGAATAAATATT
TTTACTATATGGTGCAACTCAAACTTGCACTGGACGTTCTTTTTTTTCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTACCATTCTTCACCTTCATACGCTACACATTTTTTCTTATATGCT
ACGGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATTGTAATCTCAGGTGCTCATACATTTGGGCGTGCAAAATGCAACACATTC
AGCCACAGGCTCTACAACTTCGCCAACTCCGGTGGGCCCGACCAAACCATAGAACCTACTTACCTGGAAAGGTTGCGCCAAACGTGCCCTCAAAACGGCGCCCCAACCACCTTAGAAAAT
CTTGACCAGTCAACGCCCGACGTATTCGACAACGAATACTTTGAAAATCTGCAGAGCGGGAAAGGCCTTCTTCAGACCGATCAACTATTGTTCTCTTCAACTGGAGCCGATACAGTTGCT
GTTGTCAACCGGTTCGGTGATAGCGAAACCGAGTTTTTCGATGCTTTCGTCCGGTCCATGATTAAAATGGGCAACATTGGCACGCTCACCGGGACTCAGGGAGAGATCCGAGCTGATTGC
AAGAGGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGTGTTGAGAGTGCCAATAGCAACTTTTCTCGTGCTGATATTCGTAGTTGGGTTCGGAAAAGGATGTAACGCTCAGTTGAGCACCACATTCTACGCTACCACGTGCCCTAATATA
TCGAGCGTGGTTCTTAATGTCATCGAACAGGCTCAACGGGTTGATGTTCGGTCTGCCCCCAAACTTATTCGCCTTCACTTCCATGATTGTTTCGTCAAT
GGCTGCGATGGCTCGCTTTTG
CTAGACAATGCAGACGGCATACTCAGCGAAAAAGATGCGTTCCCGAACGCTGGTTCTGTCGACGGATTCAGTTTA
GGGGGGGTCTCGTGTGCAGATATTTTGGCAATCGCTTCTCAAATT
TCAGTTAACTTG
GTAGGGGGGCCATCATATTTAGTACCACTAGGAAGAAGGGATGGAAGAACAGCAAATAGAGCAGGGGCAAATACGGAACTTCCAAGCCCTTTGGCGAACCTTAACGAA
CTTAAATCCAATTTCAGCGCCAAGGGTCTCGACTCTACTGACTTGGTCGCTCTATCAG
GTGCTCATACATTTGGGCGTGCAAAATGCAACACATTCAGCCACAGGCTCTACAACTTCGCC
AACTCCGGTGGGCCCGACCAAACCATAGAACCTACTTACCTGGAAAGGTTGCGCCAAACGTGCCCTCAAAACGGCGCCCCAACCACCTTAGAAAATCTTGACCAGTCAACGCCCGACGTA
TTCGACAACGAATACTTTGAAAATCTGCAGAGCGGGAAAGGCCTTCTTCAGACCGATCAACTATTGTTCTCTTCAACTGGAGCCGATACAGTTGCTGTTGTCAACCGGTTCGGTGATAGC
GAAACCGAGTTTTTCGATGCTTTCGTCCGGTCCATGATTAAAATGGGCAACATTGGCACGCTCACCGGGACTCAGGGAGAGATCCGAGCTGATTGCAAGAGGGTTAATTAA

Retrieve as FASTA