Entry information : SbPrx58 (Sobic.003G140600.1 [2.1] / SB03G011980 [1.4])
Entry ID 925
Creation 2006-01-03 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx58 (Sobic.003G140600.1 [2.1] / SB03G011980 [1.4])
Name (synonym) SbPrx58 (Sobic.003G140600.1 [2.1] / SB03G011980 [1.4])
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Pannicles
Seedlings
Inducers Dark growth
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx58
start..stop
S start..stop
SbPrx59 677 0 1..348 1..349
ZmPrx107 675 0 1..348 1..348
ZmPrx44 670 0 1..348 1..348
SiPrx09 622 0 1..348 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13726500..13726727 228 N° 2 13725568..13726386 819  
complement(join(13725568..13726386,13726500..13726727))


exon

Literature and cross-references SbPrx58 (Sobic.003G140600.1 [2.1] / SB03G011980 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (13726727..13725568)
EST ref. GenBank:   AW922815 [3' end]
Protein sequence: SbPrx58 (Sobic.003G140600.1 [2.1] / SB03G011980 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (320)
PWM (Da):   %s   37934.45 (35199.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.98 (6.83) Peptide Signal:   %s   cut: 29 range:29-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSAAVLFALVAVQAAVLLATVPSAQASELEVGYYSKKCKGVENVVKWHVIRAIKANRRTGAALVRLLFHDCFVRGCDGSVLLDASSDNPHPEKEARVNIGLAAFDVLEEIKAAVEKRCPGVVSCSDILIYAARDAASALSNGHVHFAVPAGRLDGFVSKADEAQAELPDSTHDVQQLIDNFARKNFTVEELVILTGAHSIGQGHCSSFRGRLSEPSSQITPAYRDLLNYKCSQGSNPPVDNNVRDEDYDVVAKFVAGFTSRVRKIPDFLDNSFYHNNLAKIVTFHSDWTLLTHKEALGHVVEYAENGTLWDEDFSESLLKLSKLPMPAGSKGEIRKKCSVVNHRLY*

Retrieve as FASTA  
Remarks Complete sequence from 4 ESTs and genomic DNA and genomic (chromo 3, intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCAGTCCTCTTCGCGCTTGTGGCTGTCCAGGCGGCGGTGCTCCTCGCCACCGTGCCGTCGGCGCAGGCCAGCGAGCTGGAGGTCGGGTACTACAGCAAGAAATGC
AAGGGCGTGGAGAACGTGGTGAAGTGGCACGTTATCAGGGCGATCAAGGCCAACCGCCGCACCGGCGCCGCCCTCGTCCGCCTTCTCTTCCATGACTGCTTCGTCAGG
GTAAGCAGCACT
AAGCACTCAAGCATGCCACCAATTCATTATAGTAAAGTGTGTGGCGTGAAATGCATGTACAACTAATTGACGGTAAACTAAATAACTAATTAACCATGCAGGGGTGTGATGGTTCTGTCC
TCCTGGACGCTTCCTCCGACAACCCTCACCCGGAGAAGGAGGCGCGGGTGAACATCGGTCTGGCCGCCTTCGACGTCCTGGAGGAGATCAAGGCCGCCGTCGAGAAGAGGTGCCCCGGCG
TGGTCTCCTGCTCCGACATCCTCATCTACGCCGCCCGCGACGCGGCCAGCGCCCTCAGCAACGGCCACGTCCACTTCGCCGTCCCGGCCGGCCGCCTGGACGGCTTCGTCTCCAAGGCCG
ATGAGGCGCAGGCGGAGCTCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTGGTCATCCTCACCGGGGCGCACTCCATCG
GCCAGGGCCACTGCTCCTCCTTCAGAGGCCGCCTCTCCGAGCCGTCGAGCCAGATCACCCCGGCGTACCGCGACCTGCTCAACTACAAGTGCTCCCAGGGATCGAACCCGCCCGTGGACA
ACAACGTCCGCGACGAGGACTACGACGTGGTGGCCAAGTTCGTGGCGGGGTTCACCAGCCGGGTGCGCAAGATCCCGGACTTCCTGGACAACTCCTTCTACCACAACAACCTCGCCAAGA
TCGTCACCTTCCACTCCGACTGGACGCTGCTCACGCACAAGGAGGCGCTCGGCCACGTCGTCGAGTACGCCGAGAACGGCACGCTATGGGACGAGGACTTCTCCGAGTCGCTGTTGAAGC
TCAGCAAGCTGCCCATGCCAGCCGGAAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCGTCAACCACCGGCTATACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCGGCGGCAGTCCTCTTCGCGCTTGTGGCTGTCCAGGCGGCGGTGCTCCTCGCCACCGTGCCGTCGGCGCAGGCCAGCGAGCTGGAGGTCGGGTACTACAGCAAGAAATGC
AAGGGCGTGGAGAACGTGGTGAAGTGGCACGTTATCAGGGCGATCAAGGCCAACCGCCGCACCGGCGCCGCCCTCGTCCGCCTTCTCTTCCATGACTGCTTCGTCAGG
GGGTGTGATGGT
TCTGTCCTCCTGGACGCTTCCTCCGACAACCCTCACCCGGAGAAGGAGGCGCGGGTGAACATCGGTCTGGCCGCCTTCGACGTCCTGGAGGAGATCAAGGCCGCCGTCGAGAAGAGGTGC
CCCGGCGTGGTCTCCTGCTCCGACATCCTCATCTACGCCGCCCGCGACGCGGCCAGCGCCCTCAGCAACGGCCACGTCCACTTCGCCGTCCCGGCCGGCCGCCTGGACGGCTTCGTCTCC
AAGGCCGATGAGGCGCAGGCGGAGCTCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTGGTCATCCTCACCGGGGCGCAC
TCCATCGGCCAGGGCCACTGCTCCTCCTTCAGAGGCCGCCTCTCCGAGCCGTCGAGCCAGATCACCCCGGCGTACCGCGACCTGCTCAACTACAAGTGCTCCCAGGGATCGAACCCGCCC
GTGGACAACAACGTCCGCGACGAGGACTACGACGTGGTGGCCAAGTTCGTGGCGGGGTTCACCAGCCGGGTGCGCAAGATCCCGGACTTCCTGGACAACTCCTTCTACCACAACAACCTC
GCCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTCACGCACAAGGAGGCGCTCGGCCACGTCGTCGAGTACGCCGAGAACGGCACGCTATGGGACGAGGACTTCTCCGAGTCGCTG
TTGAAGCTCAGCAAGCTGCCCATGCCAGCCGGAAGCAAGGGCGAGATCAGGAAGAAGTGCAGCGTCGTCAACCACCGGCTATACTAA

Retrieve as FASTA