Entry information : MguPrx93 ( mgv1a023785m)
Entry ID 9251
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: MguPrx93 ( mgv1a023785m)
Name (synonym) MguPrx93 ( mgv1a023785m)
Class Class III peroxidase    [Orthogroup: Prx084]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx93
start..stop
S start..stop
AcoPrx73 415 8e-147 21..324 15..318
MtPrx18 413 8e-146 33..324 42..333
CsPrx60 412 4e-145 26..324 57..357
CclPrx100 409 7e-145 31..324 1..296
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1553363..1553593 231 N° 2 1551981..1552724 744  
complement(join(1551981..1552724,1553363..1553593))


exon

Literature and cross-references MguPrx93 ( mgv1a023785m)
DNA ref. Phytozome 12:   scaffold_4 (1553593..1551981)
Protein sequence: MguPrx93 ( mgv1a023785m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (303)
PWM (Da):   %s   35376.09 (32948.8)  
PI (pH):   %s   9.2 (9.20) Peptide Signal:   %s   cut: 23 range:23-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRWFLLIIGAAIFIDIHSSATAAQRLPASAYLSTTYYLKSCPSFETIIHQKVNAWVKRDYTLAPAIIRLHFHDCAVRGCDASILLNRPNSERTAEASKTLRGFSLIDDIKAEVEKKCPKTVSCADILTAAARDATVLAGGPFWEVPFGRKDGKISVAKEANSVPQGYENVTSLLNFFDKMGLTFVDLVVLSGCHTVGRSTCAAVKERLYNFRGTGKADPSMNAAYVSSLKKQCGLDSNYVNFDATSPRSFDAAYYANLGKKMGLLSTDQLLYSDVRTAGVVGLMGSQAGFFKDQFLVSMVKLGNVNVLTGRNQGEVRLNCNRLNA

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTGGTTTCTTCTGATCATCGGTGCCGCCATTTTCATCGATATTCATAGTAGTGCCACCGCGGCTCAGCGGCTGCCAGCATCCGCTTACCTGTCGACAACTTATTATCTGAAATCA
TGCCCGAGTTTTGAAACCATAATCCATCAAAAAGTGAATGCTTGGGTTAAGAGAGATTACACTTTAGCCCCTGCCATCATCCGTCTTCATTTCCATGACTGCGCCGTTAGG
GTATATACC
TTCTAACTTTTTGTTGATTTTTCCGAAGAAAATTCAAATTTTATTACTCCATTTTTTCAAATTAATTGTCATTTTATATTATTTATGAATAACTCAATTACAACTCTTTCTCGTTTCCAA
GAAAATTCATTTTTTTTAGTCCGGTGTCCTCCCATTTTAAATTGCGGTCGCTTTGCGAAAAAAAAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNGAACGATTAACTATAAAAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTACTATAATGTAAATAACCACGTATAGCATCGCACTGTTCGCTTTCATCAATGATTA
ATTCCCTAAATTGTCTTAATTTTTTCCAGGGTTGCGACGCGTCGATCTTGCTGAATCGTCCCAACAGCGAGCGAACAGCCGAAGCAAGCAAAACCCTAAGGGGCTTCAGTTTGATCGACG
ACATCAAAGCGGAGGTCGAGAAGAAATGTCCCAAAACAGTCTCATGCGCCGACATCCTCACGGCGGCCGCTCGGGACGCCACCGTCCTCGCCGGAGGCCCATTCTGGGAGGTCCCATTCG
GACGGAAAGACGGCAAAATCTCCGTCGCCAAAGAGGCCAACAGCGTGCCGCAGGGGTACGAGAACGTCACATCCCTGCTCAACTTCTTCGACAAAATGGGACTCACGTTCGTCGACCTGG
TCGTGCTCTCCGGGTGCCACACCGTCGGCAGGAGCACGTGCGCCGCCGTGAAGGAGAGGCTGTACAACTTCAGAGGCACCGGGAAGGCGGACCCGTCGATGAACGCCGCTTACGTGAGCT
CGCTGAAGAAGCAGTGCGGTTTGGATTCGAATTACGTGAACTTTGATGCGACGAGTCCGAGGAGCTTCGACGCGGCGTATTACGCGAACCTTGGGAAGAAGATGGGGTTGTTGTCGACGG
ATCAGCTGCTTTACTCCGACGTGAGAACGGCGGGGGTGGTTGGTTTGATGGGTTCGCAGGCGGGGTTCTTTAAGGACCAGTTTCTTGTGTCGATGGTGAAGCTGGGGAATGTGAATGTGT
TGACGGGGAGAAACCAGGGTGAAGTCAGATTGAACTGCAATCGTCTCAATGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTGGTTTCTTCTGATCATCGGTGCCGCCATTTTCATCGATATTCATAGTAGTGCCACCGCGGCTCAGCGGCTGCCAGCATCCGCTTACCTGTCGACAACTTATTATCTGAAATCA
TGCCCGAGTTTTGAAACCATAATCCATCAAAAAGTGAATGCTTGGGTTAAGAGAGATTACACTTTAGCCCCTGCCATCATCCGTCTTCATTTCCATGACTGCGCCGTTAGG
GGTTGCGAC
GCGTCGATCTTGCTGAATCGTCCCAACAGCGAGCGAACAGCCGAAGCAAGCAAAACCCTAAGGGGCTTCAGTTTGATCGACGACATCAAAGCGGAGGTCGAGAAGAAATGTCCCAAAACA
GTCTCATGCGCCGACATCCTCACGGCGGCCGCTCGGGACGCCACCGTCCTCGCCGGAGGCCCATTCTGGGAGGTCCCATTCGGACGGAAAGACGGCAAAATCTCCGTCGCCAAAGAGGCC
AACAGCGTGCCGCAGGGGTACGAGAACGTCACATCCCTGCTCAACTTCTTCGACAAAATGGGACTCACGTTCGTCGACCTGGTCGTGCTCTCCGGGTGCCACACCGTCGGCAGGAGCACG
TGCGCCGCCGTGAAGGAGAGGCTGTACAACTTCAGAGGCACCGGGAAGGCGGACCCGTCGATGAACGCCGCTTACGTGAGCTCGCTGAAGAAGCAGTGCGGTTTGGATTCGAATTACGTG
AACTTTGATGCGACGAGTCCGAGGAGCTTCGACGCGGCGTATTACGCGAACCTTGGGAAGAAGATGGGGTTGTTGTCGACGGATCAGCTGCTTTACTCCGACGTGAGAACGGCGGGGGTG
GTTGGTTTGATGGGTTCGCAGGCGGGGTTCTTTAAGGACCAGTTTCTTGTGTCGATGGTGAAGCTGGGGAATGTGAATGTGTTGACGGGGAGAAACCAGGGTGAAGTCAGATTGAACTGC
AATCGTCTCAATGCT

Retrieve as FASTA