Entry information : MguPrx94 (mgv1a024280m)
Entry ID 9252
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx94 (mgv1a024280m)
Name (synonym) MguPrx94 (mgv1a024280m)
Class Class III peroxidase     [Orthogroup: Prx018]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx94
start..stop
S start..stop
GmPrx34 262 1e-88 3..210 4..203
GmPrx34 58 0.0000000002 167..212 274..319
VvPrx20 258 7e-87 1..201 1..192
VvPrx20 66 0.0000000000003 167..212 272..317
GmPrx89 257 1e-86 1..210 1..203
GmPrx89 75 2e-16 167..212 274..319
CroPrx69 257 2e-86 9..201 8..193
CroPrx69 78 2e-17 167..212 274..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62910..63125 216 N° 2 62629..62820 192 N° 3 61567..61792 226  
complement(join(61567..61792,62629..62820,62910..63125))


exon

Literature and cross-references MguPrx94 (mgv1a024280m)
DNA ref. Phytozome 12:   scaffold_139 (63125..61567)
Protein sequence: MguPrx94 (mgv1a024280m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212 (187)
PWM (Da):   %s   22439.29 (19840.0)  
PI (pH):   %s   8.03 (8.11) Peptide Signal:   %s   cut: 26 range:26-212
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLTNNSFLTLSIIASLLFSCSNAQLSPNFYASTCPNLQLIVRNAMREAITQELRIGASILRLFFHDCFVNGCDGSLLLDDTATFTGEKNAFPNRNSVRGYELIDTIKTRVEAACSATVSCADIVALAARDGVGLMGGPTWTVPVGRRDARTASLSGANSEIPxxDSLVRFYSSNLNAFRADFAAAMVRMGNISPLTGANGEIRRNCRLVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Big gap in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCTTACAAATAATTCATTTCTCACTCTATCCATAATAGCATCACTTCTTTTCAGCTGCAGCAATGCACAGCTCTCGCCGAATTTCTACGCTTCCACATGCCCTAATCTGCAACTCAT
AGTGCGGAACGCTATGAGAGAAGCCATCACTCAAGAACTCAGGATCGGTGCATCCATCCTCCGTCTGTTCTTCCACGATTGCTTCGTTAATGTACG
TAACAAATTGCGCTCGTTTAAATT
AATTATTATCGGTCACTTTTTCTTATTTTTTTAAATTGTTTTGTTAATTGATGTAATTAGGGTTGTGACGGATCGTTGTTGCTAGACGACACAGCCACATTCACTGGGGAAAAGAATGCG
TTTCCGAACCGGAATTCGGTGAGAGGTTATGAATTGATCGACACTATCAAGACTCGTGTGGAAGCTGCTTGCAGCGCCACGGTTTCTTGTGCGGATATTGTGGCCTTGGCTGCAAGAGAT
GGAGTAGGCTTGGTAAT
TACTACTAATTCACTACGTAAATTATCGGTTAATATATACAACTTTATATTGCATGCAATTCTAGCTAGCTTTATATTATCTATAATTTTCCTACTTCATTGC
ATATTCAAGTTTTTGCAGTTGTGACATATGCATTATCATAAAATCAACATGGATTATATACATTATCGAATGAATTCTCTTACGAGCGTGTGCTATTACGTCGAAATGTATCTGAATTTA
CCTCATCGAGTTATAGTTATATTTGTTACCAATTATACGCTCTCTCGTTTTTGTATAAGCCAAACTCACTTTCTCATATAATTTATTTTACAATCGAATTCCTTCTACTTAAAAATAAAA
ACCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNTAGATAATATATATAAAATTAGACAATTAAAATTTGAATAGAATCCAATTTCATACTTGATACAATGTTATATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATGACCAGTTGATCCCCATGAGAAAACTATTCTATTATTGG
ACATGTAGATGGGAGGGCCCACATGGACGGTCCCCGTCGGAAGAAGGGACGCGAGAACCGCCAGCCTGAGCGGCGCGAACTCCGAAATCCCAGNNNNNGATTCGTTGGTCAGGTTTTACA
GCAGTAATTTAAATGCTTTCAGGGCTGATTTTGCTGCGGCGATGGTGAGGATGGGGAATATTAGCCCACTCACTGGGGCTAATGGAGAGATTAGAAGGAACTGCAGGCTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCTTACAAATAATTCATTTCTCACTCTATCCATAATAGCATCACTTCTTTTCAGCTGCAGCAATGCACAGCTCTCGCCGAATTTCTACGCTTCCACATGCCCTAATCTGCAACTCAT
AGTGCGGAACGCTATGAGAGAAGCCATCACTCAAGAACTCAGGATCGGTGCATCCATCCTCCGTCTGTTCTTCCACGATTGCTTCGTTAATGTACG
TGACGGATCGTTGTTGCTAGACGA
CACAGCCACATTCACTGGGGAAAAGAATGCGTTTCCGAACCGGAATTCGGTGAGAGGTTATGAATTGATCGACACTATCAAGACTCGTGTGGAAGCTGCTTGCAGCGCCACGGTTTCTTG
TGCGGATATTGTGGCCTTGGCTGCAAGAGATGGAGTAGGCTTGGTAAT
AGGGCCCACATGGACGGTCCCCGTCGGAAGAAGGGACGCGAGAACCGCCAGCCTGAGCGGCGCGAACTCCGA
AATCCCAGNNNNNGATTCGTTGGTCAGGTTTTACAGCAGTAATTTAAATGCTTTCAGGGCTGATTTTGCTGCGGCGATGGTGAGGATGGGGAATATTAGCCCACTCACTGGGGCTAATGG
AGAGATTAGAAGGAACTGCAGGCTTGTTAATTAA

Retrieve as FASTA