Entry information : MguPrx98 (mgv1a025312m)
Entry ID 9255
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguPrx98 (mgv1a025312m)
Name (synonym) MguPrx98 (mgv1a025312m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx98
start..stop
S start..stop
VvPrx65 504 0 9..321 7..323
CclPrx43 503 0 9..320 9..324
CsPrx20 501 0 9..320 11..326
NtPrx44-1A 496 5e-179 21..321 21..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1306526..1306735 210 N° 2 1306825..1307016 192 N° 3 1307103..1307663 561  
join(1306526..1306735,1306825..1307016,1307103..1307663)


exon

Literature and cross-references MguPrx98 (mgv1a025312m)
DNA ref. Phytozome 11:   scaffold_22 (1306526..1307663)
Protein sequence: MguPrx98 (mgv1a025312m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   34552.27 (31981.9)  
PI (pH):   %s   5.08 (4.76) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKNCKSTLWVLTILILVRSGQGQLLLNFYGPRCPNVEGIVRQAVLTKINQTFVTIPATVRLFFHDCFVDGCDASVLIASPNNDAEKDSPDNLSLAGDGFDTVVKAKQAVEAQCPGIVSCADILALAARDVVLLAGGPAYNVELGRRDGLVSQASRVAGNLPDPHFNLGQLNTMFATHGLSQTDMIALSGCHTLGFSHCNRFADRIYSNPIDPTLDPNYAQLLMQMCPRDVDPRIAIDMDPVTPRTFDNVYYQNLVGGKGLFTSDQVLFTDPASQPTVLGFAQNPGDFNGAFITAMTKLGRVGVKTGDQGEIRRDCSAFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAAACTGTAAGAGTACTTTGTGGGTGTTGACAATTTTGATACTTGTGAGGAGCGGACAAGGCCAGTTGCTGCTGAATTTTTACGGTCCAAGATGTCCGAATGTGGAGGGTATT
GTTCGTCAGGCTGTGTTAACAAAGATAAACCAGACTTTCGTTACCATTCCTGCCACTGTTCGCCTCTTTTTCCACGACTGCTTTGTTGAT
GTATTTTCATCTCGATCTTTTCAACTAATT
TACATAAACTACTAACAAGTTTTTCAACAACTTTACCAAAACTATGCAATATATTGTAGGGGTGTGATGCATCTGTTCTAATAGCGTCACCGAATAACGACGCGGAAAAAGATTCCCCGG
ACAATCTATCCCTAGCAGGAGATGGATTCGACACTGTTGTAAAGGCAAAACAAGCAGTAGAAGCTCAATGCCCTGGGATTGTATCATGTGCTGACATTTTAGCTCTTGCTGCCAGAGATG
TTGTCCTCCTG
GTAATAACAACAATATAATGAATTTATTATTTTTCCGAAAATCACACACTCATTTATATATTATTTTGTAAATGGATTCTATTCAGGCAGGGGGTCCCGCATACAACGT
AGAACTGGGGAGGCGTGACGGTCTCGTTTCTCAAGCTTCTCGGGTGGCAGGAAATTTGCCGGATCCTCATTTCAATCTTGGCCAGCTCAACACAATGTTTGCGACCCATGGTCTGTCACA
AACCGATATGATTGCACTGTCAGGTTGCCACACGCTCGGGTTTTCACACTGCAACCGTTTTGCGGACCGGATATATTCCAACCCGATCGACCCGACCCTGGATCCGAATTACGCACAGCT
GCTGATGCAGATGTGCCCGCGTGATGTCGACCCGAGGATCGCCATTGATATGGATCCAGTGACTCCACGAACATTCGACAATGTCTACTATCAGAATCTGGTTGGTGGGAAAGGCTTGTT
TACTTCTGATCAGGTGCTGTTCACCGATCCAGCTTCTCAGCCTACTGTCCTGGGTTTTGCTCAAAACCCGGGTGATTTTAACGGGGCGTTTATTACAGCTATGACTAAGCTTGGAAGAGT
TGGTGTCAAAACAGGTGACCAGGGAGAAATTAGGAGGGATTGCTCTGCCTTCAACTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAAACTGTAAGAGTACTTTGTGGGTGTTGACAATTTTGATACTTGTGAGGAGCGGACAAGGCCAGTTGCTGCTGAATTTTTACGGTCCAAGATGTCCGAATGTGGAGGGTATT
GTTCGTCAGGCTGTGTTAACAAAGATAAACCAGACTTTCGTTACCATTCCTGCCACTGTTCGCCTCTTTTTCCACGACTGCTTTGTTGAT
GGGTGTGATGCATCTGTTCTAATAGCGTCA
CCGAATAACGACGCGGAAAAAGATTCCCCGGACAATCTATCCCTAGCAGGAGATGGATTCGACACTGTTGTAAAGGCAAAACAAGCAGTAGAAGCTCAATGCCCTGGGATTGTATCATGT
GCTGACATTTTAGCTCTTGCTGCCAGAGATGTTGTCCTCCTG
GCAGGGGGTCCCGCATACAACGTAGAACTGGGGAGGCGTGACGGTCTCGTTTCTCAAGCTTCTCGGGTGGCAGGAAAT
TTGCCGGATCCTCATTTCAATCTTGGCCAGCTCAACACAATGTTTGCGACCCATGGTCTGTCACAAACCGATATGATTGCACTGTCAGGTTGCCACACGCTCGGGTTTTCACACTGCAAC
CGTTTTGCGGACCGGATATATTCCAACCCGATCGACCCGACCCTGGATCCGAATTACGCACAGCTGCTGATGCAGATGTGCCCGCGTGATGTCGACCCGAGGATCGCCATTGATATGGAT
CCAGTGACTCCACGAACATTCGACAATGTCTACTATCAGAATCTGGTTGGTGGGAAAGGCTTGTTTACTTCTGATCAGGTGCTGTTCACCGATCCAGCTTCTCAGCCTACTGTCCTGGGT
TTTGCTCAAAACCCGGGTGATTTTAACGGGGCGTTTATTACAGCTATGACTAAGCTTGGAAGAGTTGGTGTCAAAACAGGTGACCAGGGAGAAATTAGGAGGGATTGCTCTGCCTTCAAC
TCA

Retrieve as FASTA