Entry information : CpapAPx02 (evm.TU.contig_30593.1 / Carpa1_181-PACid_16429847)
Entry ID 9258
Creation 2011-06-28 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-30 (Christophe Dunand)
Peroxidase information: CpapAPx02 (evm.TU.contig_30593.1 / Carpa1_181-PACid_16429847)
Name (synonym) CpapAPx02 (evm.TU.contig_30593.1 / Carpa1_181-PACid_16429847)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Caricaceae Carica
Organism Carica papaya    [TaxId: 3649 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpapAPx02
start..stop
S start..stop
LeAPx04 481 1e-175 1..250 1..250
VvAPx02 481 2e-175 1..250 1..250
QshAPx01 480 4e-175 1..248 1..248
CroAPx02 479 8e-175 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7160..7278 119 N° 2 6899..7073 175 N° 3 6710..6775 66 N° 4 5842..5890 49
N° 5 5669..5751 83 N° 6 5477..5556 80 N° 7 5152..5332 181  
complement(join(5152..5332,5477..5556,5669..5751,5842..5890,6710..6775,6899..707 3,7160..7278))


exon

Literature and cross-references CpapAPx02 (evm.TU.contig_30593.1 / Carpa1_181-PACid_16429847)
DNA ref. Phytozome 11:   contig_30593 (7278..5152)
Protein sequence: CpapAPx02 (evm.TU.contig_30593.1 / Carpa1_181-PACid_16429847)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27568.03  
PI (pH):   %s   5.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAYPQVSEEYQKAVEKCKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTMKHPAELAHAANNGLDIAVRLLEPIKEQFPILSYADFYLAGVVAVEITGGPEIPFHPGRPDKKDPPPEGRLPDATKGSDHLRDVFGHMGLSDKDIVALSGGHTGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEDLLQLPSDKALLEDPVFRPLVEKYAADEDAFFADYAEAHLKLSELGFADAE

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCGTATCCGCAAGTGAGTGAAGAGTACCAGAAGGCTGTGGAGAAATGTAAGAGGAAGCTTAGAGGATTGATCGCTGAGAAGAACTGTGCTCCCCTAATGCTTCGTTTAGCG
TACGCTCTCTCTCTCTCTCTCTATATTTCTCTTTCTCCATTTATGGGTTTTCATGGATTCATGTTTTTCTTTTTGGGTTTTGCAGATGGCATTCAGCTGGGACTTTCGATGTGAAGACGA
AGACAGGTGGGCCGTTCGGGACGATGAAGCACCCAGCAGAACTTGCTCATGCCGCCAACAATGGTCTTGATATTGCTGTCAGGCTTTTGGAGCCTATCAAGGAGCAGTTCCCGATCTTAT
CTTATGCGGATTTCTATCAG
GTAATTTGTTATCATTGTTATTCATCAATGGAAGTTCTGTTTCTTTTTCCCTCTGTTTTCCCTTTTTGGCTACTTTTTGGGGTTTTGTAAAATGATCTTG
GGTTCTGTCTTTGATGGGTGAAGTTGGCTGGAGTTGTTGCCGTTGAAATCACCGGAGGACCTGAGATTCCTTTCCACCCAGGAAGACCGGTCAGTGATTCTCCTTACTTTTGTTCCTTTA
TGTATTATCTTTTGAGCAGGAAATTTTTCAAAAAAAAAAAAAAGTATTTTCAACTGGAAAATCGGATGATACTTATCTTGATATTGGGAAAGGAAAATTGTTGCCTGTGATTACGTTAAT
TTCGGTAGGACTTGAGAAAATGTTGCATGTGAACCTTAGATGAAGCTTTAGCACAACTATGTTTGATAAAATTAAGATAATGTTTCTTTCTTTTTTATTATTATGTTCCTGGGTATGTAT
GTATAAGATGGGATCCTTTATATTTCTGAAATTACGGGAATTTTTTGTTTTTCAGAAACTCGTATATGTTATACACACATTGATTCAATGATAATAAGATTTGAAAGGTGATAGTGAAAA
TGCAACATGGTTTTGGGAAAAAGAATATTTTTAAAGCTTATGTTTTTATTTTGTCGTTTTTCAATTGTTTTCATTTTCCACAAGTATATGTATATGGTTATGTGATAAATTTACATAACA
CAGTTTTCTACAACTAATAGGGTTTAATCTTTTTAAGTTTTTGAGGATAAGCAACATTTCACTTGCTTGGACCGGAATAAAGAACAAATCTGCTAGCATTCAAATTTCCCTTTGCTACGA
TGTTAACTATCTTTGGAAGCGCTAAGCATCTATCAGTTCTACTTGTGCATACTTGAAATGTGCTGTCCATTCCTTAAAACAAAACATGTAAAACTTGCAGTAGAGGGGAAAGAGCAAAAA
CTAATAGGTTTTATTCAATCTCTATAAATTCTTTCTTCAAGAATTCTGAATTTTCAGTTTTGCTTCAGGACAAGAAAGACCCACCTCCAGAGGGCCGCTTGCCAGATGCTACTAAAGGTA
AGTTAATTTGCTGTAGTTCAGAAATACCGAAGTCAACCGTTCAACTCTTCTTCAGAATTGCTTATATACATAATATCTTGCTAATAGGTTCTGATCACCTGAGGGATGTGTTTGGCCACA
TGGGTCTTAGCGACAAAGACATTGTTGCATTATCTGGTGGTCACACTCTG
GTGAGTTGACAAAGCTGGTTCCTTTTAAATTGCTATTTCTTGGAATAAAATCCTATAATTGTTCTGGGTT
TTTCTTTGCCATGCTGATCAACCTACCTGGTTACCATTTCAGGGTAGGTGCCACAAGGAGCGTTCTGGATTTGAGGGACCATGGACCACCAACCCTCTCATTTTCGATAACTCCTATTTC
AA
GTAAGATCATCACTTCTTGTAGTTCTTCTCGCCTAAATCGAAATGAATGGTTCTGAATATAGTTTTGCACCTATATATAAGTAAAATCTACAAAAGAAAAAGACAGGAGCAACCATCT
AACTCTTATCATTTTTTTTCAAACAGGGAACTTCTAAGTGGAGAGAAAGAAGATCTTCTTCAGTTGCCATCAGACAAGGCTCTTCTTGAGGATCCTGTCTTCCGTCCCCTTGTGGAGAAG
TATGCTGCAGATGAGGATGCCTTCTTTGCAGATTACGCAGAAGCTCATTTGAAGCTGTCAGAGCTTGGATTTGCAGATGCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCGTATCCGCAAGTGAGTGAAGAGTACCAGAAGGCTGTGGAGAAATGTAAGAGGAAGCTTAGAGGATTGATCGCTGAGAAGAACTGTGCTCCCCTAATGCTTCGTTTAGCA
TGGCATTCAGCTGGGACTTTCGATGTGAAGACGAAGACAGGTGGGCCGTTCGGGACGATGAAGCACCCAGCAGAACTTGCTCATGCCGCCAACAATGGTCTTGATATTGCTGTCAGGCTT
TTGGAGCCTATCAAGGAGCAGTTCCCGATCTTATCTTATGCGGATTTCTATCAG
TTGGCTGGAGTTGTTGCCGTTGAAATCACCGGAGGACCTGAGATTCCTTTCCACCCAGGAAGACCG
GACAAGAAAGACCCACCTCCAGAGGGCCGCTTGCCAGATGCTACTAAAGGTTCTGATCACCTGAGGGATGTGTTTGGCCACATGGGTCTTAGCGACAAAGACATTGTTGCATTATCTGGT
GGTCACACTCTG
GGTAGGTGCCACAAGGAGCGTTCTGGATTTGAGGGACCATGGACCACCAACCCTCTCATTTTCGATAACTCCTATTTCAAGGAACTTCTAAGTGGAGAGAAAGAAGAT
CTTCTTCAGTTGCCATCAGACAAGGCTCTTCTTGAGGATCCTGTCTTCCGTCCCCTTGTGGAGAAGTATGCTGCAGATGAGGATGCCTTCTTTGCAGATTACGCAGAAGCTCATTTGAAG
CTGTCAGAGCTTGGATTTGCAGATGCTGAGTAA

Retrieve as FASTA