Entry information : PpeAPx01 (ppa009538m)
Entry ID 9260
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpeAPx01 (ppa009538m)
Name (synonym) PpeAPx01 (ppa009538m)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpeAPx01
start..stop
S start..stop
HaAPx03 479 2e-173 1..287 1..285
CsAPx03 477 2e-172 1..287 1..287
CclAPx03 475 8e-172 1..287 1..287
LsaAPx02 473 5e-171 1..287 1..285
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16395671..16395783 113 N° 2 16395304..16395428 125 N° 3 16394627..16394676 50 N° 4 16394393..16394458 66
N° 5 16394249..16394297 49 N° 6 16393830..16393912 83 N° 7 16393661..16393740 80 N° 8 16392550..16392652 103
N° 9 16391220..16391414 195  
complement(join(16391220..16391414,16392550..16392652,16393661..16393740,1639383 0..16393912,16394249..16394297,16394393..16394458,16394627..16394676,16395304..1 6395428,16395671..16395783))


exon

Literature and cross-references PpeAPx01 (ppa009538m)
DNA ref. Phytozome 11:   scaffold_8 (16395783..16391220)
Protein sequence: PpeAPx01 (ppa009538m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288
PWM (Da):   %s   31419.08 Transmb domain:   %s   o258-280i
PI (pH):   %s   6.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPLVDKEYLKEIEKARCDLRALIYSSSCAPLMLRLAWHDAGTYDAKTKTGGPNGSIRTEEEYSHGSNNGLKKAVDFCEEVKSKHPRISYADLYQLAGVVAVELTGGPAIDFSPGRKDSKISPKEGRLPDAKRGAPHLREKFYRMGLSDKDIVALSGGHTLGRAHLERSGFDGPWTKEPLQFDNSYFVELLNGESEGLLKLPTDAALVEDPEFRKYVDLYAKDEDAFFGDYAESHKKLSELGFTPISSSTNTAKDSTILAQGAVGVAVAAAVVILGYLYEAKKRLK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCACCGCTCGTTGACAAAGAGTACCTCAAAGAAATCGAGAAGGCTCGCTGTGATCTCCGTGCTCTGATATACAGCAGTAGCTGTGCTCCCCTCATGCTTCGCTTGGCGTATGCT
CTCTCTCTGTGTTTGTTTCCCATGAAAAAAATTGCGATGAAAAGACAATCCGAAGGAAACATTGAGTCGAGATATATTTTTGTTTTCATTTCCTGTGATTTCTCAGTAGCTCAGTGTATC
ATATCTACACATTGAGCTTTTTTTGGATTGTTTTTGTAAATGAAATATTTTGCATGTCATTGTTTGTGTCGATTTTGTTGAAATTATGACTGTTCTTGGATATGTGAATTTGTAGATGGC
ACGATGCTGGCACCTACGACGCCAAGACGAAGACGGGAGGGCCTAATGGGTCGATTAGGACTGAGGAAGAGTACTCTCATGGTTCTAATAATGGCTTGAAGAAGGCTGTTGATTTTTGCG
GTATGCTTGTGTTGCTTTATTTTATCAATATTTGTTCGATTTTTTCAACTTTGATCTTACAAATTGTAAAATTTACACCTTAAACATGGGCTGGGTACATGAGAAGTGAAAACTAAGATA
ATTGTTCTGTGTTGTGTGTGCTGATAATTTGTCCATGGGTTGTTTTTTTGAATTTATTTGTGATCTTGAGGAGTATTGTATTTGTTCTTAGATATGAGCACTGAACCCAAATATAATTTG
TTGTTTAAATAGTGCAACTATGCTACTATTGGTATTGTTTGCAATTAATAGCTCAAATCCTTGATGAAAGGGGAATTTAGCAAGTTCAGATGGTTTTACTATATTGCATATGTAGCTCAG
CAGACTCGCATTGTGCTTACATTCGCTTTGTGCTTACTTTAGCTTCAGACTCTCATTTCTAAGAAAAGGGAACTACATTGAAACCGCACATAAGAAAGCATGTATAACAGTTGTCAATAT
GTTGCATATGAGGTTACCTCCAAGGTGCCCTACATTTGCCGATATTTGTGTAGTAAAAATACCATTCTTATGGCTGTTATACAATGTTCTCATCGCTTTCTTCATTTATTTATTCTTTTT
TCTGGGTGCTTCTCTTTCTGGTGTCAGAGGAAGTGAAGTCTAAGCATCCAAGGATTTCATATGCAGACCTTTACCAGGTGATTATAGTTTTGCAAGAGTTACTCTTCCTATATTTTAGTT
CATCCACTCTCAAATTAAGAGATTTTACAAAGATCATAAGAGTTTTTTTCCTTGAATTTGTTGGACATAGCGTGGAATCTTTAATGAAGATACTGATTAGGGGACATGATTACTTGTACT
CTCAGCTTGCGGGTGTTGTTGCAGTTGAGCTGACTGGAGGCCCCGCCATTGATTTTTCTCCTGGCAGAAAGGTATGTTGTGGTCAATGGTCAGTTATTTCAAGAAACATACCGAGTCTCC
CTATCATTGTTTTTCAAGTTTTCATTTGCTTTTTGGTCCTTTATAGGATTCAAAAATCTCTCCTAAGGAAGGACGACTTCCAGATGCTAAACGAGGTCAATTCCAATACCTAAGATCACT
TCTGCAAATTTTATTTCACCCTACTTTAATGTATTGGTATTCTGGTTTGCTTTATATACTAGCATCTTGATTGAATTATAACTCCTAATTGGGATTTCTCAATTATCCCATGCTATAAGC
TGCTTTCATGTGACAACTCAACCCACTTCCCCTTCCCCCCACTCTCTCTTCTATCTTTGTTAATGTATTTAAGCATGCTGAAGTTGTTACGCTTGCTTCTGTTTGCTTGCGTATGATTTT
CAGTTAAATTGTTTGGAAGATGACAATTTTTTTTCCATAAAAGAGAGTTGAATTTCTTGTTGGGTTTATAGGTGCACCACATCTGAGGGAAAAATTCTACAGAATGGGGTTGTCTGACAA
GGATATTGTTGCACTATCTGGGGGCCATACACTG
GTAATTATTCCTTCTTGTTTGCATCTATACATGGTCTTCGTTTGTATTTGACAGACATGTTTACTCTCTGTCAATTTCTGTGGTCA
TAGGGAAGGGCACATCTCGAGAGATCTGGTTTTGATGGTCCTTGGACTAAGGAACCTCTGCAGTTCGATAACTCATACTTTGTGTAAGACTTTTCAACATGGGTGTGGTTATGAANNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNTAGCCATCATAAGATTCATTTGAGTTAGTACTAGGTCTAGTTCCTATGCTCATAGATCCAAAACTAATCGCCATGTCCTCTTCAGATGGATTGGAGGTCCTCTTCAGATGGA
TTGGAGGTATGTGGGCAATGGATTGTGCGTAGATTCTTCATATTAAAGGATTAGCTATTTTTGGGTTTCAATTTGCTTCAATTGTCTTCAAAACTTCTGAATTTTTTTTGGGTTCTGTTA
TGGGTATCGGGAAATATCGGGGATATCGGCAAAATATCAGGGATATCGCACTTATCGGGGATATATCGTCGATACAGGGGAAGATATGGCCTTACCCCCCAGTATCGGTGTCGACAGTTG
AAAATACCGATATATCTGTGTATTGGCCGATATTTCAATCCTTGGTTATGAACATGCATTTGTACTCATTATGCATTATGTGCAAGTGTCTATGGTTATGAACTTTCATTCGTATTCATT
GTTGATACCAGGGAACTGTTAAATGGGGAATCAGAGGGGCTGTTGAAACTTCCGACAGATGCAGCTTTAGTGGAAGATCCTGAGTTCCGTAAATATGTTGATCTGTATGCGAAGGTAATT
TGGGTTTGGGCTCGTTCAGTTCTATTTTGCTATGAAAAAATGTTTGGGGAATTTATCACTGCTTGTTTATATTAACACTCTTGGTTCAGAATTCTTAGAATTACTTTAGTCCTTGTTATT
ATAGAAGCTGGTTGCTGCCCTTACGAAATAATCAAATGTGGCCTTACCCATGTTCTCGTGGTGTATATAATCTGATCAACTGATCAGCCCTGACACGTCAATCACTTGGGAACTGGTAAA
TTTAGTTCAAACCGTTTATAAGATGCCTTACTTCTTATATTTCCCGGGTAAGTTGTAAGCAATCCTATAACAACAGGTTTGGGCAGATTGAAAGCTTTTTGTTTCACCAACTTGCAGTGG
AGCATACTCAATCCTATCATCTCTCCTCGCTTTGTTCTATAAAGTTAAAAAAAATTGTTATTTTCCTGTGAATTATGCTTTTATGTAAAATTGACATCAATTTGGGCCGGGCTTTTCTCA
GAATTGATTTAACTGATACTGGGTTAGATCAGGCTCTTGCTCTACTATGCAATACCACAACACCTCTTCAGATGATTGTGGCGCCTTCGAAGCTGAGGCTAATTTGGCTAATTTTGACAT
TTGTGATGGGTCTTGGGGCAGGAACCATTTGCAGTTGATACCAAACCCCCAATTTGGTGTTTGGTTGAATTGATTAAACTTTGTTACTTGGCTAGTGATGCACATGAGAAGGTTTGGGGC
CTGGCCCAACTGGGGAGACTTAACTCATGGAGATGAGTTTTAAAATTAAAACCAGTGGCATGATGTAGATGGTCTTCTCTTGTGTTGTCTGGTCCTACTGTGCATATTTATCATATTATT
ACAATAGTTAGGTAATATGGTGGGACGGAAAATGCGAGGATGGGAATCAATACACCCCTTGAGGCATAGATGGCGGTGAATGTTTACCTTGAAGTGGGACGCGGAGCAGGGACGGGACCA
AATTTTTTTAGGGCAAGGCTGGAATAGTGAATGCGATCCTGACCATATTGTGTCTTGTGCCATCCCAATGCTTTGATGTTTCCTAAAACAACATATCTTTGTCTGTTTATATATCTGTTT
TCTTTTGACATTCCTTTTCTTACTTACGTAAATTTGGCATACGGTGCAGGATGAAGATGCATTTTTTGGAGATTATGCCGAATCGCATAAAAAACTTTCAGAGCTTGGGTTTACTCCAAT
CTCCTCTTCTACTAACACAGCAAAGGACAGCACCATACTGGCACAAGGTGCAGTAGGAGTTGCAGTTGCTGCTGCTGTTGTGATCCTAGGCTACTTGTATGAAGCTAAGAAAAGACTGAA
GTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCACCGCTCGTTGACAAAGAGTACCTCAAAGAAATCGAGAAGGCTCGCTGTGATCTCCGTGCTCTGATATACAGCAGTAGCTGTGCTCCCCTCATGCTTCGCTTGGCATGGCAC
GATGCTGGCACCTACGACGCCAAGACGAAGACGGGAGGGCCTAATGGGTCGATTAGGACTGAGGAAGAGTACTCTCATGGTTCTAATAATGGCTTGAAGAAGGCTGTTGATTTTTGCG
AG
GAAGTGAAGTCTAAGCATCCAAGGATTTCATATGCAGACCTTTACCAG
CTTGCGGGTGTTGTTGCAGTTGAGCTGACTGGAGGCCCCGCCATTGATTTTTCTCCTGGCAGAAAGGATTCA
AAAATCTCTCCTAAGGAAGGACGACTTCCAGATGCTAAACGAG
GTGCACCACATCTGAGGGAAAAATTCTACAGAATGGGGTTGTCTGACAAGGATATTGTTGCACTATCTGGGGGCCAT
ACACTG
GGAAGGGCACATCTCGAGAGATCTGGTTTTGATGGTCCTTGGACTAAGGAACCTCTGCAGTTCGATAACTCATACTTTGTGGAACTGTTAAATGGGGAATCAGAGGGGCTGTTG
AAACTTCCGACAGATGCAGCTTTAGTGGAAGATCCTGAGTTCCGTAAATATGTTGATCTGTATGCGAAG
GATGAAGATGCATTTTTTGGAGATTATGCCGAATCGCATAAAAAACTTTCA
GAGCTTGGGTTTACTCCAATCTCCTCTTCTACTAACACAGCAAAGGACAGCACCATACTGGCACAAGGTGCAGTAGGAGTTGCAGTTGCTGCTGCTGTTGTGATCCTAGGCTACTTGTAT
GAAGCTAAGAAAAGACTGAAGTAG

Retrieve as FASTA