Entry information : PpeAPx04 (ppa010426m)
Entry ID 9263
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpeAPx04 (ppa010426m)
Name (synonym) PpeAPx04 (ppa010426m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpeAPx04
start..stop
S start..stop
PtriAPx02 477 6e-174 1..250 1..250
CclAPx05 476 2e-173 1..250 1..250
CroAPx02 476 3e-173 1..250 1..250
CsAPx02 473 5e-172 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22195459..22195577 119 N° 2 22195178..22195352 175 N° 3 22195007..22195072 66 N° 4 22194494..22194542 49
N° 5 22194329..22194411 83 N° 6 22194150..22194229 80 N° 7 22193960..22194062 103 N° 8 22193779..22193837 59
N° 9 22193660..22193678 19  
complement(join(22193660..22193678,22193779..22193837,22193960..22194062,2219415 0..22194229,22194329..22194411,22194494..22194542,22195007..22195072,22195178..2 2195352,22195459..22195577))


exon

Literature and cross-references PpeAPx04 (ppa010426m)
DNA ref. Phytozome 12:   scaffold_6 (22195577..22193660)
Protein sequence: PpeAPx04 (ppa010426m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27606.91  
PI (pH):   %s   5.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKCYPTVSEEYQKAVDKCKRKLRGHIAEKHCAPIILRLAWHSAGTFDVQSKTGGPFGTIRHPEELAHEANNGLDIAVRLLEPIKEKFPILSYADFYQLAGVVAVEITGGPDVPFHPGRPDKQEPPPEGRLPDGSKGSDHLRDVFGHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELFSGEKEGLIQLPSDKALLEDPVFRPLVETYAADEDAFFADYAEAHLKLSELGFADAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAATGCTACCCGACTGTGAGCGAGGAATATCAGAAGGCAGTGGATAAATGCAAGAGAAAGCTCCGAGGACACATCGCTGAAAAGCACTGCGCTCCTATAATTCTCCGATTAGCG
TAAGAATCAAGAACTCTCTCTGCCATATGCTTAATGATCTGAGAGCTCCATCTGTTGGTAACGGTTGGTGTTTGCTTTGTGTTTGATGTTTGGTGATGATCGCAGATGGCATTCGGCTGG
TACCTTCGACGTGCAAAGCAAGACAGGAGGGCCGTTCGGGACCATAAGGCACCCGGAGGAGCTTGCTCATGAAGCAAACAATGGCCTGGATATTGCGGTCAGGCTCTTGGAGCCGATCAA
GGAGAAGTTTCCGATTCTCTCATACGCAGATTTCTACCAG
GTATATAGATATTTGTTGAGAATATTTGGCTTGGGTTTTGGTTTTGGTTTTTAGTTTAAATTTGTAGATCGATGTTGTGA
GTTTTTATTTGATTGTGTTTTGAAGTTGGCCGGAGTTGTTGCTGTGGAAATTACAGGGGGGCCTGATGTTCCTTTCCACCCTGGTAGACCGGTAAGTGCCTTCTTGGCTTATTTTCAATT
ACTGGCCCATTTCTTGTCGTTCAAATCACAATATAAAACATACGCAAAAGTAACTCATTAAAATTATATAAATTGAAAGTTCATACAGGCATGTCATACTGTGATTGTCTCGAGATTTCC
TTTATTATATGCCCAAAACCTATTTCCTATAGCACATGTAGTTCACATTTGTTTGTCCTTTTTTTTACAATAATAATTAGCCTTGTGTTGTCGAATAATTGGAAATTATATAGGATCAAA
GAGCTTGGTCTAATGAAACTTGATTGATTTGCTGGTTTTTTAGGTTATTGACATTGACAATACAATATGTGATGGTATTGATTGTTTAGAGTGCCTTTCTCGGCTCTCAAACAATGCAGG
CATGGCAAGATTGTTTTAAAATGTGATCTTATTTTAAACTTGTACTCATTGGTTCAATTCATGTACTAATTTCAGGACAAACAAGAACCGCCACCAGAAGGTCGCTTGCCGGATGGCTCC
AAAG
GTAAGTTAGCGGCTAGATTTTGCAACTAGTGTATGGTTGTAAGATGAATTTGCTTAATTTTTGTTTGTGTTGTTCCTTTTAGGTTCGGATCATTTGAGGGATGTCTTTGGTCACAT
GGGTCTTAGTGACAAGGATATTGTTGTATTATCCGGTGGACACACATTG
GTCAGTTCATGCAAGACCATCAAAACTCTTCTATTTTTTTCATTTACTGGTAGAGTTTAGCATTTTAAATA
TTGTGTGTTTGGGGAATTTTTTTTTCAGGGTAGGTGCCACAAAGAACGTTCTGGATTTGAGGGACCCTGGACAACCAACCCCCTCATTTTTGACAACTCCTATTTCAAGTAAAGACCTAT
TCATCTTCTTCAATAATAACACTGTTGAATTTATACCACTTTCTAGATAGTTAATCTGATTTGTTTCCCAAACAGGGAACTTTTTAGTGGAGAGAAAGAAGGCCTTATCCAGCTGCCATC
AGACAAGGCTCTTCTGGAGGATCCAGTCTTTCGTCCTCTTGTTGAGACCTATGCCGCG
GTTTGTATCTGATCGTGCTTTATACTTAATATGATCACTAAATTATGGCTTAGCTATACTCT
TTTTATGTCTTGATGTTAATTTGATCCCGTTTTCGGTTGCTGTGATTTTGCTTTGACTAGGACGAGGACGCTTTCTTTGCGGATTATGCCGAAGCGCATTTGAAACTCTCAGAGCTTGGG
TGAGTATGAAAAACACCTCACTTTTTATTGATTTCCTTCTATAATTCTCCATAGTTGCTCACATTGTAACATGCCAATGTTTTTTGTTTTTTTTTCCAGATTCGCTGATGCCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAATGCTACCCGACTGTGAGCGAGGAATATCAGAAGGCAGTGGATAAATGCAAGAGAAAGCTCCGAGGACACATCGCTGAAAAGCACTGCGCTCCTATAATTCTCCGATTAGCA
TGGCATTCGGCTGGTACCTTCGACGTGCAAAGCAAGACAGGAGGGCCGTTCGGGACCATAAGGCACCCGGAGGAGCTTGCTCATGAAGCAAACAATGGCCTGGATATTGCGGTCAGGCTC
TTGGAGCCGATCAAGGAGAAGTTTCCGATTCTCTCATACGCAGATTTCTACCAG
TTGGCCGGAGTTGTTGCTGTGGAAATTACAGGGGGGCCTGATGTTCCTTTCCACCCTGGTAGACCG
GACAAACAAGAACCGCCACCAGAAGGTCGCTTGCCGGATGGCTCCAAAGGTTCGGATCATTTGAGGGATGTCTTTGGTCACATGGGTCTTAGTGACAAGGATATTGTTGTATTATCCGGT
GGACACACATTG
GGTAGGTGCCACAAAGAACGTTCTGGATTTGAGGGACCCTGGACAACCAACCCCCTCATTTTTGACAACTCCTATTTCAAGGAACTTTTTAGTGGAGAGAAAGAAGGC
CTTATCCAGCTGCCATCAGACAAGGCTCTTCTGGAGGATCCAGTCTTTCGTCCTCTTGTTGAGACCTATGCCGCG
GACGAGGACGCTTTCTTTGCGGATTATGCCGAAGCGCATTTGAAA
CTCTCAGAGCTTGG
ATTCGCTGATGCCGAGTAA

Retrieve as FASTA