Entry information : PpeAPx05 (ppa008008m)
Entry ID 9264
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpeAPx05 (ppa008008m)
Name (synonym) PpeAPx05 (ppa008008m)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpeAPx05
start..stop
S start..stop
VvAPx07 565 0 1..349 1..344
CclAPx01 559 0 1..349 1..349
CpapAPx06 549 0 1..349 4..347
PtAPx10 544 0 1..349 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41836967..41837068 102 N° 2 41836692..41836790 99 N° 3 41836412..41836496 85 N° 4 41836293..41836327 35
N° 5 41836122..41836187 66 N° 6 41835973..41836013 41 N° 7 41835398..41835528 131 N° 8 41835173..41835279 107
N° 9 41834210..41834347 138 N° 10 41833827..41833961 135 N° 11 41833637..41833747 111  
complement(join(41833637..41833747,41833827..41833961,41834210..41834347,4183517 3..41835279,41835398..41835528,41835973..41836013,41836122..41836187,41836293..4 1836327,41836412..41836496,41836692..41836790,41836967..41837068))


exon

Literature and cross-references PpeAPx05 (ppa008008m)
DNA ref. Phytozome 11:   scaffold_1 (41837068..41833637)
Protein sequence: PpeAPx05 (ppa008008m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350
PWM (Da):   %s   38395.94  
PI (pH):   %s   6.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVSFLSTVPSLLPLVPVPLNIAATSGSRYPTVSVTIRCNKIEVDTANEDRFHRRDILKCVGATIGMELIRSSGTFVEVAEAADLIQRRQRSEFLSSIKDTLYQAIANRDIIPSLLTLALNDAITYDKASKSGGPNGSIRFSSEISRPENKGLTAALNFIEEAKKEIDLYSKGGPISYADLIQLAQSATKQTFLAAAIRKCGGNEEKGNLLYTAYGSNGQWGLFERNFGRSDTQEPDPEGRVPQWDKASVQELKDKFSALGLGPRLAVLSAFLGPDQVATETLLAADPEVFPWVQKYQRSRETVSETDYEVDLITTFTKLSSLGQQINYEAYTYPVKKVDFSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTCTCCTTCCTATCAACTGTCCCTTCCTTGCTTCCACTTGTTCCTGTCCCTCTCAACATTGCTGCTACCTCTGGCTCCAGATACCCAACTGTTTCTGTAAGTTTTCTTTTTGCC
TATGGTACGTACTTGTTTCTCTACACGTCTTTTGAGAAATGGGTTGCTCTTAAATGACAGAAAAGTGCTCTTCGTTTGTATTGTTTTCATTTGAACCCAGTTGTTTGACATTTGCTTATA
TGAGTAGTGATTGTAGGTTTTGTGATATCGAATTGCAGGTTACAATTCGTTGTAATAAAATTGAAGTTGATACTGCTAATGAGGATAGGTTTCATAGGAGGGACATTCTCAAATGTGTTG
GTGCCACCATTGGCATG
GTGAGAGCTTTCTTCTCTTTATTATTTGTGAAAATAATGTATCTACTTCATTAAGCTCTGGCAGAGACCCAATTTTCATTATGAGCAACGATATCCATATTTA
TCATTAAAATGCAGCTCAACTTAATAAATGTAGAATTCCATAAATTAGAGTGAATTGATGATGAGTTTCTGCCAGTTGTAATATCTTCTTAGGAATTGATAAGAAGCTCAGGAACATTTG
TTGAAGTGGCTGAGGCTGCTGATCTGATACAACGCAGACAGCGTTCTGAATTTCTTT
GTAAGTTTTTTGAATGCTTGTTCCAATGCTAGACTTGAATCATCTACAATATGCTGATCCAGA
TGCCTATTCCCTTCTAAACAGCAAGTATCAAGGACACCCTTTATCAAGCTATAAAGGTAAATATTAGTGATAGTCATGCTGTATTTAGACCCCATTCACAGTTTAGATTCATCATTCTTC
AACTTCATGAGATATTTTCTCCGATCTCCTGTTCGTTTCAGGCAAATCGAGACATTATCCCATCCTTACTAACTCTGGCACTGAATGATGCTATCACTTATGATAAGGTCAGACAAAAAA
CTTTGCCCTTTGAATTCCATAATATTTCTTTGTTTGGTTAAATATTACTGAGGGAGGAATACAAAATACTTACCTATTTCTGATCAATGTTTTAGGCTTCAAAATCTGGGGGACCAAATG
GATCTATCAGATTCAG
GTAAACATTATGCACAGGATTTTCTTTAATATGATTTTTTCATTGAAGTGTAACCTTTTCCTCCTGTAATCTTATATTCAAACTGGAGTGGGACTTCATTTTTA
CTCTCTTTAACTTTCTTTATGCAATTTATAGTGAAGACAAGTCTCTGTTTATAATCATAAGAAGGATGCTTTTCCCAAAGCAACTGGATGATATTTTAGGATGTTTACTCTTATGATTTT
TCATTTTACTAGCTTCTTGATCTACCAGGCACGAGTTCTGATATTGTTAAAGTGTTACAACTGAATGGGAAAAGGACTAAAAACGTGAACTTTGCATGAAATCGTTGCATTGCAGTTTCA
GTTTCTTCTTTCTCTATCCTTTCTTTTCTCTGTGCAATTTGGTTTTTAACCTTGTACAAAAGCTACCTTCACTTTCTTCTCCACTTTTTCTTGCATAAAGCTCAGAGATAAGCAGACCTG
AAAACAAGGGGCTCACTGCTGCTTTGAATTTCATAGAAGAAGCAAAGAAGGAAATTGATTTGTATTCCAAGGGTGGACCCATTTCCTATGCTGATCTGATCCAATTAGCAG
GTTGTACAA
TATCACAATATTTGAAACATGCATCGTTGACATGGCATTGAATGACATATGGGGGTTGTTTGATAAATGGTACCATGGTCTATAATTCAGTTGCCTTCATTCTATACAGCACAAAGTGCC
ACAAAGCAAACCTTTCTTGCTGCTGCAATTCGCAAATGTGGAGGGAATGAAGAGAAGGGAAATTTATTATACACTGCATATGGTTCAAATGGTCAG
GTTTGTTCTCCATTTGTCTTGTTT
ACAGATACTCCGAATACCATTAGGTCGTTATTGAAACCGTTGATTTATAATTTATATGGTCAGTGTTTTAAGTTCTTGATATATTGAATTAATTATTAGATGAATTTATTTTAGTATCAA
TACTACATGGTACTCTTTGTGTGATTTCAGCCTGAAACAGCTGATTATTAAAATGGTGTTTGAGAATGATTCTCACATGAAAGTTCAGTTGAGAAATAACCCTCACAGTTGTCTTTGTCA
GTAGATCAACCTGATGGTCCTCAGAGACATAGGATGTCTTCTATTTTATTTTCCCTTTTCCAGGATCAGATTCTAAAACAAACAGGGTTCCAGTTTTGTTTATGAGTTAGCCAAGTTCTG
TGATTCTGTCAGTGAATTTGTAATGAAATTAGGCTCTACTATATAAAACTAGCTTTTTTCATGCCAGTTAAATCATGGGTTAAAGGTTTGGTAGAGTTGATTCTTAAACTGTGTCGACAT
ATTAATTCTTCTTACTGCATTGATGCATTTTCAAATGAACTGGTGTTTATATTTGAAGTGATTGGTTGTATAAACTTGAAAATGTGCAAGTTTCTTTCTCCCCACTTTTTGCTTAGCAAG
ATTTGAATCTAGGACCATCCTCATCGCAACCTTACCACCTGAGTAAAGCTCAGCTGGCATCGGGAATTTATTTGATGTAGGAATACTTGTTTATAAAGCTTATTAGAGGTCCATACATAT
AATTAGCTGCATTAATTTTCTTCACTATAGGAAATTATGGGTTAAGGCATGTAATGCATACAACCATTCTTGTGCCAACAGTGGGGCTTGTTTGAAAGGAATTTTGGACGGAGCGATACC
CAGGAGCCAGACCCAGAGGGAAGGGTTCCCCAGTGGGACAAAGCAAGTGTGCAGGAATTGAAGGACAAGTTCTCTGCCCTTGGCTTGGGACCCCGCCAG
GTTTTCTTGGTTTTTTTAATT
TACTTATACAGCTGCAATTGCATGTTAGGATCGTTCTTCTTTACCAAGTTCAACCATGAACCTTAAAAACAAACAGACTTGCAGCGCAAGAAAATCACTCCATGGTTGAACTTGTGAACT
TTAGATGAAGAAGAATGGCAGTTCTTGTAGCAATGGAACTTCTTCTGTCACTACTTTTGGGGTCATTATTAATGATTATTGATTCTAGCATATTATTGTTTTGCCAGCTAGCTGTTCTGT
CTGCATTCTTGGGTCCTGATCAGGTAGCCACAGAAACTTTATTAGCTGCTGATCCTGAAGTTTTTCCATGGGTTCAGAAATATCAACGTAGCCGAGAAACAGTATCCGAAACAGATTATG
AG
GTCAGTGCAATCTGGAAATATGTCTGCATGGTTTTGTTAACATTTTAGATCTCACTGTTGGTTTAAAATTCTCTTTCAGGTTGATCTGATCACTACTTTCACAAAACTGAGTAGTTTG
GGACAACAAATCAATTATGAGGCGTATACTTATCCAGTCAAAAAAGTAGATTTCAGCAAACTCAAATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTCTCCTTCCTATCAACTGTCCCTTCCTTGCTTCCACTTGTTCCTGTCCCTCTCAACATTGCTGCTACCTCTGGCTCCAGATACCCAACTGTTTCTGTTACAATTCGTTGTAAT
AAAATTGAAGTTGATACTGCTAATGAGGATAGGTTTCATAGGAGGGACATTCTCAAATGTGTTGGTGCCACCATTGGCATG
GAATTGATAAGAAGCTCAGGAACATTTGTTGAAGTGGCT
GAGGCTGCTGATCTGATACAACGCAGACAGCGTTCTGAATTTCTTT
CAAGTATCAAGGACACCCTTTATCAAGCTATAAAGGCAAATCGAGACATTATCCCATCCTTACTAACTCTGGCA
CTGAATGATGCTATCACTTATGATAAG
GCTTCAAAATCTGGGGGACCAAATGGATCTATCAGATTCAGCTCAGAGATAAGCAGACCTGAAAACAAGGGGCTCACTGCTGCTTTGAATTTC
ATAGAAGAAGCAAAGAAGGAAATTGATTTGTATTCCAAGGGTGGACCCATTTCCTATGCTGATCTGATCCAATTAGCAG
CACAAAGTGCCACAAAGCAAACCTTTCTTGCTGCTGCAATT
CGCAAATGTGGAGGGAATGAAGAGAAGGGAAATTTATTATACACTGCATATGGTTCAAATGGTCAG
TGGGGCTTGTTTGAAAGGAATTTTGGACGGAGCGATACCCAGGAGCCAGACCCA
GAGGGAAGGGTTCCCCAGTGGGACAAAGCAAGTGTGCAGGAATTGAAGGACAAGTTCTCTGCCCTTGGCTTGGGACCCCGCCAG
CTAGCTGTTCTGTCTGCATTCTTGGGTCCTGATCAG
GTAGCCACAGAAACTTTATTAGCTGCTGATCCTGAAGTTTTTCCATGGGTTCAGAAATATCAACGTAGCCGAGAAACAGTATCCGAAACAGATTATGAG
GTTGATCTGATCACTACTTTC
ACAAAACTGAGTAGTTTGGGACAACAAATCAATTATGAGGCGTATACTTATCCAGTCAAAAAAGTAGATTTCAGCAAACTCAAATTGTAG

Retrieve as FASTA