Entry information : PpePrx14 (ppa008516m)
Entry ID 9266
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx14 (ppa008516m)
Name (synonym) PpePrx14 (ppa008516m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx14
start..stop
S start..stop
VvPrx30 504 0 1..328 1..327
VvPrx31 500 2e-180 1..328 1..327
EcamPrx163 487 3e-175 1..328 1..326
NtPrx18-1B 485 2e-174 1..328 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16727411..16727632 222 N° 2 16727813..16728001 189 N° 3 16728102..16728267 166 N° 4 16728376..16728785 410
join(16727411..16727632,16727813..16728001,16728102..16728267,16728376..16728785 )


exon

Literature and cross-references PpePrx14 (ppa008516m)
DNA ref. Phytozome 12:   scaffold_3 (16727411..16728785)
Protein sequence: PpePrx14 (ppa008516m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35441.42 (32545.8)  
PI (pH):   %s   9.53 (9.54) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATQKLISVLLLQLLLVLLASDFSNGQKLKVGFYHKTCPNLEAIVAKTTQHYISRAPTLAAPLLRLHFHDCFVRGCDGSVLLNSTASNSAEKDAIPNLSLRGFHVIDAAKSAVEKKCPGVVSCADILALVARDAVRMLPGSFWEVPTGRRDGRVSVNSEALRGLPSPFANITQLKAKFASKGLSVKDLVVLSGGHTIGTSHCDSFSSRLYNFTGKGDTDPKLDKNYIARLKKKCKPGDTKTLVEMDPGSFKSFDEDYYTLVAKRRGLFHSDSALLDDPETRAYVIQQATSHGGATFLKDFGASMVNMGNIGVLTGNSGEIRKQCALVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTCAGAAGCTTATCTCAGTTTTGTTGCTTCAACTCCTGCTTGTTCTGTTGGCCTCAGACTTCAGCAATGGGCAGAAGTTGAAAGTTGGGTTTTACCACAAAACATGCCCAAAC
TTAGAGGCTATTGTGGCAAAAACTACTCAGCATTACATATCTCGCGCACCAACTCTTGCTGCTCCTTTGTTAAGGCTGCATTTTCATGATTGTTTTGTTAGG
GTATGTTGTTTGGTTGCA
TTCGTTACTTGCCTAATCCATCAAATGTTGATCAGGCAATATGTACTTGTATGCATTACTAGTCCATGCATGCACATAATTTCCTCCACTAAAAAAGTTGCAGAACAATTGTTAAGGACT
GAATTTTGTTCCTAGCTAACTCCATTAAATTTTGATTTGCAGGGATGTGATGGTTCTGTGCTGTTGAATTCCACCGCGAGCAATAGCGCTGAGAAAGATGCAATCCCCAACCTAAGCTTA
AGAGGGTTCCATGTCATAGATGCTGCGAAATCTGCAGTAGAAAAGAAGTGTCCTGGTGTTGTTTCTTGTGCTGATATCTTGGCATTGGTAGCTCGAGACGCAGTAAGAATG
GTAAAAAGA
AACTAATCTTGTATCCACATAATTCTATAATTTTACTGCATATGTTGTTAAATAATCGGGTAGCTTTACTGAATCGATATTTTAATTTCAGCTTCCTGGATCATTTTGGGAGGTTCCGAC
AGGACGTAGAGATGGAAGAGTGTCAGTAAACTCAGAGGCCTTAAGAGGGTTACCATCTCCTTTTGCAAACATAACACAGCTCAAAGCAAAATTTGCTTCAAAGGGTCTAAGTGTTAAAGA
CCTAGTGGTTCTATCAG
GTGACGAATCTTAAGTTTGATAAAGAATTTTTTGTTTGTCTGGTTGTTTTTGTTTCATGAAACTCTAACTAACTTATAAGCTCCTTTTTTTTTTTTCCCTTGT
CTCAGGAGGACACACCATCGGAACATCTCACTGCGATTCCTTTTCAAGTCGCTTGTACAATTTCACCGGTAAAGGAGACACAGACCCGAAATTGGACAAAAACTACATAGCTCGGCTGAA
GAAAAAATGTAAGCCAGGGGACACCAAAACCCTGGTTGAAATGGACCCTGGAAGCTTCAAATCATTTGATGAAGATTACTACACTCTTGTCGCCAAAAGAAGAGGACTTTTCCATTCTGA
TTCAGCTCTTCTTGATGACCCTGAGACAAGAGCCTATGTGATACAGCAAGCCACCTCTCATGGTGGAGCCACCTTCCTAAAAGACTTTGGTGCCTCAATGGTAAATATGGGAAACATTGG
GGTCCTCACAGGCAACTCAGGTGAAATAAGGAAGCAATGTGCTCTTGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTCAGAAGCTTATCTCAGTTTTGTTGCTTCAACTCCTGCTTGTTCTGTTGGCCTCAGACTTCAGCAATGGGCAGAAGTTGAAAGTTGGGTTTTACCACAAAACATGCCCAAAC
TTAGAGGCTATTGTGGCAAAAACTACTCAGCATTACATATCTCGCGCACCAACTCTTGCTGCTCCTTTGTTAAGGCTGCATTTTCATGATTGTTTTGTTAGG
GGATGTGATGGTTCTGTG
CTGTTGAATTCCACCGCGAGCAATAGCGCTGAGAAAGATGCAATCCCCAACCTAAGCTTAAGAGGGTTCCATGTCATAGATGCTGCGAAATCTGCAGTAGAAAAGAAGTGTCCTGGTGTT
GTTTCTTGTGCTGATATCTTGGCATTGGTAGCTCGAGACGCAGTAAGAATG
CTTCCTGGATCATTTTGGGAGGTTCCGACAGGACGTAGAGATGGAAGAGTGTCAGTAAACTCAGAGGCC
TTAAGAGGGTTACCATCTCCTTTTGCAAACATAACACAGCTCAAAGCAAAATTTGCTTCAAAGGGTCTAAGTGTTAAAGACCTAGTGGTTCTATCAG
GAGGACACACCATCGGAACATCT
CACTGCGATTCCTTTTCAAGTCGCTTGTACAATTTCACCGGTAAAGGAGACACAGACCCGAAATTGGACAAAAACTACATAGCTCGGCTGAAGAAAAAATGTAAGCCAGGGGACACCAAA
ACCCTGGTTGAAATGGACCCTGGAAGCTTCAAATCATTTGATGAAGATTACTACACTCTTGTCGCCAAAAGAAGAGGACTTTTCCATTCTGATTCAGCTCTTCTTGATGACCCTGAGACA
AGAGCCTATGTGATACAGCAAGCCACCTCTCATGGTGGAGCCACCTTCCTAAAAGACTTTGGTGCCTCAATGGTAAATATGGGAAACATTGGGGTCCTCACAGGCAACTCAGGTGAAATA
AGGAAGCAATGTGCTCTTGTTAATTGA

Retrieve as FASTA