Entry information : PpePrx16 (ppa008550m)
Entry ID 9268
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx16 (ppa008550m)
Name (synonym) PpePrx16 (ppa008550m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx16
start..stop
S start..stop
LjPrx70 498 1e-179 1..327 1..327
GmPrx59 488 2e-175 12..327 12..326
CpapPrx22 481 7e-173 19..327 15..323
GmPrx233 472 2e-169 11..327 10..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37542116..37542328 213 N° 2 37542442..37542639 198 N° 3 37542975..37543140 166 N° 4 37543248..37543654 407
join(37542116..37542328,37542442..37542639,37542975..37543140,37543248..37543654 )


exon

Literature and cross-references PpePrx16 (ppa008550m)
DNA ref. Phytozome 12:   scaffold_1 (37542116..37543654)
Protein sequence: PpePrx16 (ppa008550m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   36292.55 (33544.0)  
PI (pH):   %s   9.26 (9.26) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNVQSLFSLPLLFLLLVLLNSAHAQLHVEHYRSSCPNVEAIVHAAVKQKFEQTFVTAPATLRLFFHDCFIRGCDASIMLAFRNNSAEKDNSDNLSLAGDGFDTVIKAKAAVDRVPQCRNKVSCADILALATRDVVRLTGGPYYRVELGRLDGRTSTKASVRQHLPHPDFRLDQLNSMFASHGLSLTDLIALSGAHTIGFAHCNKFTHRIYSFKSQNRIDPTMNLAYARHLKQECPANVDPRIAVDMDPTTPQKFDNVYYKNLQQGKGLFTSDQSLFTDARSRKIVNLFAADAAAFERAFVAAMTKLGRFGVKNGKQGEIRHDCAAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGTTCAAAGCCTTTTCTCTCTTCCTTTACTCTTTCTTCTTCTTGTCCTCTTGAACTCAGCTCATGCTCAGCTTCATGTAGAACATTACAGAAGCTCATGCCCAAATGTTGAAGCA
ATTGTGCATGCTGCAGTCAAACAGAAGTTTGAGCAGACATTTGTGACAGCTCCAGCCACTCTGAGGCTCTTCTTCCATGATTGTTTCATCCGG
GTACTTGGGGTTTTTCTCCTAACACAA
ACTTTACATTTTTGCGTATACTTATACAAATTTATATATTTATACATGCAACTGCAACAATGAGTGTGAGATTTTTGGCTATATAGGGATGTGATGCTTCAATAATGCTAGCTTTTCGGA
ACAATTCAGCAGAGAAGGACAACTCCGATAACCTTTCGCTCGCTGGAGACGGGTTTGATACCGTGATCAAAGCCAAGGCTGCTGTTGATAGAGTGCCCCAGTGCAGGAACAAGGTTTCTT
GTGCTGACATTCTGGCCTTGGCCACAAGGGATGTCGTAAGACTG
GTAAACAAAGCAAGGAAGCACCATTATTTCTTTTGTCTCTTTTAGGTTAAGGGATTATGGTAACTGCACTTTTTAC
TAAGAAAATTCTTGTTTCAGCAAATCTCGTGCAAGAAATAGAAGGATCCAATGTGATCAAGGGTTTATGCACTGTGCATTCACATGAAGTGCTGTACAGTGCAGAATCCATTTTCACCTC
AATGTGGGGTGCAAAAGCACTTTATCCCTTTTCACTGCTAGAAAAATCTAAAAAAAAGAAAGAGGAATTTTCTTTGTACATTCCATATTAAGTCAAATAATGTGCATGCTTTTAACGCAT
TCTCTTGGTCTTGGTGCAGACTGGGGGACCATATTACAGAGTTGAATTGGGAAGACTTGATGGGAGGACTTCTACAAAAGCCAGTGTGAGACAACATCTTCCTCATCCTGATTTTAGGTT
AGACCAGCTGAATTCGATGTTCGCCTCCCACGGTCTCTCTCTAACCGATCTCATTGCACTCTCAG
GTATTTGAAGAACCAAAAATCTTAAACAGAACAAAAACAAACAAAGTTATGCAGA
ACCTATTTTTGATCCAATCTTTGTTGTTGTTTTTTCATTTTCTTTGTTGTAGGTGCACATACAATTGGATTCGCGCACTGCAACAAATTCACTCACCGGATATACAGTTTCAAAAGCCAG
AACAGAATTGATCCAACGATGAACTTGGCATATGCAAGGCATCTCAAACAAGAGTGTCCAGCAAATGTAGACCCCAGAATTGCTGTTGACATGGACCCAACCACACCCCAAAAGTTCGAC
AATGTCTACTACAAGAACCTGCAGCAAGGAAAAGGGTTGTTTACTTCTGATCAGTCTTTGTTCACTGACGCCAGATCAAGAAAAATTGTCAACTTGTTTGCAGCAGACGCCGCCGCTTTC
GAACGGGCTTTTGTGGCTGCCATGACAAAGCTTGGAAGATTTGGAGTTAAGAATGGAAAGCAGGGTGAAATTAGGCATGATTGTGCTGCTGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGTTCAAAGCCTTTTCTCTCTTCCTTTACTCTTTCTTCTTCTTGTCCTCTTGAACTCAGCTCATGCTCAGCTTCATGTAGAACATTACAGAAGCTCATGCCCAAATGTTGAAGCA
ATTGTGCATGCTGCAGTCAAACAGAAGTTTGAGCAGACATTTGTGACAGCTCCAGCCACTCTGAGGCTCTTCTTCCATGATTGTTTCATCCGG
GGATGTGATGCTTCAATAATGCTAGCT
TTTCGGAACAATTCAGCAGAGAAGGACAACTCCGATAACCTTTCGCTCGCTGGAGACGGGTTTGATACCGTGATCAAAGCCAAGGCTGCTGTTGATAGAGTGCCCCAGTGCAGGAACAAG
GTTTCTTGTGCTGACATTCTGGCCTTGGCCACAAGGGATGTCGTAAGACTG
ACTGGGGGACCATATTACAGAGTTGAATTGGGAAGACTTGATGGGAGGACTTCTACAAAAGCCAGTGTG
AGACAACATCTTCCTCATCCTGATTTTAGGTTAGACCAGCTGAATTCGATGTTCGCCTCCCACGGTCTCTCTCTAACCGATCTCATTGCACTCTCAG
GTGCACATACAATTGGATTCGCG
CACTGCAACAAATTCACTCACCGGATATACAGTTTCAAAAGCCAGAACAGAATTGATCCAACGATGAACTTGGCATATGCAAGGCATCTCAAACAAGAGTGTCCAGCAAATGTAGACCCC
AGAATTGCTGTTGACATGGACCCAACCACACCCCAAAAGTTCGACAATGTCTACTACAAGAACCTGCAGCAAGGAAAAGGGTTGTTTACTTCTGATCAGTCTTTGTTCACTGACGCCAGA
TCAAGAAAAATTGTCAACTTGTTTGCAGCAGACGCCGCCGCTTTCGAACGGGCTTTTGTGGCTGCCATGACAAAGCTTGGAAGATTTGGAGTTAAGAATGGAAAGCAGGGTGAAATTAGG
CATGATTGTGCTGCTGTGAACTAA

Retrieve as FASTA