Entry information : PpePrx20 (ppa008607m)
Entry ID 9270
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx20 (ppa008607m)
Name (synonym) PpePrx20 (ppa008607m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx20
start..stop
S start..stop
PpePrx19 614 0 1..325 1..326
CclPrx07 512 0 7..325 6..323
CsPrx15 512 0 7..325 6..323
GhPrx13 504 0 24..325 22..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2008623..2008844 222 N° 2 2010566..2010757 192 N° 3 2010914..2011082 169 N° 4 2011241..2011635 395
join(2008623..2008844,2010566..2010757,2010914..2011082,2011241..2011635)


exon

Literature and cross-references PpePrx20 (ppa008607m)
DNA ref. Phytozome 12:   scaffold_6 (2008623..2011635)
Protein sequence: PpePrx20 (ppa008607m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (298)
PWM (Da):   %s   34724.55 (31914.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.65 (9.64) Peptide Signal:   %s   cut: 28 range:28-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGRSSSLCSIWVIVLLVGFTGSSSAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCTSFRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLINQKGLLHSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIRLNCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGGTAGGAGTTCTTCTCTGTGTTCCATATGGGTGATTGTCCTTCTTGTGGGTTTCACAGGGAGCTCTTCTGCTCAGCTCTCTACAAATTTCTATTCGAAGAGTTGCCCTAAG
GTTTTTGATGCAGTCAAATCTGTTGTGCAGTCTGCTGTGAACAAAGAAAAGCGCATGGGAGCTTCCCTCCTTCGCCTTCACTTTCATGACTGCTTTGTTAAT
GNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATCTATAGGAAGAGGGGACTCGAATCTGGGTGCAAGAGGGTGGGCTCACTGTCTTGGCTAACTGACTTAA
CCCACATTTAATTTATCTATGTTACATATTAATTAAGTACGGCTCATGGGCGGTGCTATGCACAGGGCAGCCCGCCTAGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTACATGTG
TTATAAGCCCATCCNNNNNNNNNNNNNNNNNNNNNNCAAACCCTACACATATGTTGCCCATCCAGGTGGTCTCATATCTTCTCTCCTTCTCTTTCGGCCTATTAGACTTCTTGTTTCTCC
CTCTCTCTTTGCTACCCGATAGCAACAAGTTTCTCCTCTCTTTTTTTGGGGTCAAATTCTTCCTCTATTTGCTACATCTTCTATTATTTTGGATGGGCAATTTGGCAATAATATATTCTC
CTCTCCTTTTGTTAACAAGAAGTATTATTCTCATTCTCTCCTTTGCTATATATCCTTAATTATAGTTTTAATTTAAAATCGAGTATTTTAGGAATTAAGGATGAATTTTAACTCTGGGAT
TTTGTTGAAATTAATTAGGGCTTTGATTAGGGATGAATTCTTGTATGGCTTTGATTTGAGATTTTGTTAAAATTGAGTATTCTAGGGCTTAGTTATGGGTGAATTATAAATTTTGGTTTG
GTATTATTGATATGCTATTATGAAAATTTGTTTGATTTTTTATTGTATGTTTGATTAAAAATATTTCTACATATTATTCATAGACTATCTTTTAAGAGTTTCAAGCTTAACAAAGTTAAA
TTTTAAATTTAAATAGTGTTGTTTTGTATTGCATTGCATTTACTTTTTATTTTAGTTTTTAGCTTTGTTGAACTTTTATTGAAATCAGTTTTCAAGTCGTAGGACTTGTCGGCAGAAATA
ATCTCTACATTAAACATGAACAGCCCTAATTTGTATTTTTTTGTTTTTTATTATGTTAACAGTTTATGATGAACTTTAACACGTATATCTCATATGCTGTCACGTCATACTACCTCTTAA
TAATGAAATGATAGCATGCATTATTTTTCTTGTTTTTATTTATATATTATGAAGAAAAACATGTGATATTGTTTGTAATTACAAATTCTGTCTGCCCTGCTGTTGTCAAAGTTCAATCAT
TGTGTCACATCTACAATAATAATGTATAGGAGATGATGAAAACAAATGAACTTGTATTTGCATGAAAAAGAAAAACATGGTTCTCCTCACTTTTCTATGTTCTCCCCTACGAAAATTTAA
ATATGCTGCACGCAGGTTGAAGACGTGCATATATGGCAAAAGTCCTAGTCTTCGATGATGAAATCCCAAAGGCGCCCTTTACGGCAGTAAAATATTTTCAACATCATGGGGGCATGAACA
TACCTAATACCAATAATTAATTTTCTCAGTGTCTCCTTATTCAAATTATGTTGGTGTTTAATTAGTAAACATCGCATACATGTTGACTTTACAGTTTCATGTTTAAACAATTATATATCT
TAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTGTGGGTTAGACCAATTGACTAAAGTAGTGTGTCTACCTTTTCTTTGTACGTGAGTTCGATCTCCCTTCCCGTACCTAATCCTGT
GGTGTTTAATTGATCATAACCAGGGTTGTGATGGGTCTATACTGCTCGACGACACTTCTTCTTTCACAGGAGAGAAGACTGCACGTCCCAATAATAACTCTGTTAGGGGATTTGAGGTTG
TGGATAACATTAAGTCCCAAGTGGAAAAAACATGTCCCGGCGTCGTTTCATGTGCTGATATTTTAGCCATTGCTGCTCGAGACTCCGTTAAGATT
GTGAGTAACAAATACAAATTTTTCA
CTTAATTTTACACATCACAACAAAAACACATGATACTAATTATGCTAAATTAACAGTTAATATCCAATATTTTTAGGGATATTAATTTATTCTATTAACACTTAGAAACTTTGCTTTTTA
TTTTGTTGCAGCTTGGAGGACCAAGTTGGAATGTTAAACTTGGAAGAAGGGATTCCAAGACAGCTAGCCTCGCTGCTGCCAACAGTGGAGTCATCCCTCCTCCCACTTCTACCCTCAGCC
AGCTCAAAACTAGATTCCAAGCTGTAGGTCTCAATGAAAGGGACTTGGTAGCCCTATCTG
GTAACAATCACAGCACCCCCTTAACTGATGTGTCAGTATTTCATTTGTTTACATTCGATG
ATCTATGATTCTCATTTATATATAACAATTAAAACGTTTGTATACAAAAAAGGTTAATTTTGTCAGATAATCTAACATGTTATGTTACGTGATGGCAGGAGCGCACACAATCGGGCAAGC
AAGGTGCACATCTTTCAGAGCTCGCATATACAACGAGACCAACATTGATGCATCATTTGCCAAGGCCAGGCAAAGCAAATGCCCAAGTACCGTTGGCTCAGGAGACAACAACCTTGCACC
TTTGGACGTCCAAACTCCCAACACTTTTGACACTGCTTACTTCAAGAACCTCATCAACCAAAAGGGCCTCCTCCACTCTGACCAAATTCTCTACAACAATGGTGGATCCACAGATTCATT
GGTTAAAACGTACAGCGGCAGTGCCAATACCTTCAATTCTGACTTTGCCAAGGCAATGATCAAGATGGGAGATAATAAGCCACTCACTGGATCCAACGGTGAGATTAGATTGAACTGTAG
GAGGCCTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGGTAGGAGTTCTTCTCTGTGTTCCATATGGGTGATTGTCCTTCTTGTGGGTTTCACAGGGAGCTCTTCTGCTCAGCTCTCTACAAATTTCTATTCGAAGAGTTGCCCTAAG
GTTTTTGATGCAGTCAAATCTGTTGTGCAGTCTGCTGTGAACAAAGAAAAGCGCATGGGAGCTTCCCTCCTTCGCCTTCACTTTCATGACTGCTTTGTTAAT
GGTTGTGATGGGTCTATA
CTGCTCGACGACACTTCTTCTTTCACAGGAGAGAAGACTGCACGTCCCAATAATAACTCTGTTAGGGGATTTGAGGTTGTGGATAACATTAAGTCCCAAGTGGAAAAAACATGTCCCGGC
GTCGTTTCATGTGCTGATATTTTAGCCATTGCTGCTCGAGACTCCGTTAAGATT
CTTGGAGGACCAAGTTGGAATGTTAAACTTGGAAGAAGGGATTCCAAGACAGCTAGCCTCGCTGCT
GCCAACAGTGGAGTCATCCCTCCTCCCACTTCTACCCTCAGCCAGCTCAAAACTAGATTCCAAGCTGTAGGTCTCAATGAAAGGGACTTGGTAGCCCTATCTG
GAGCGCACACAATCGGG
CAAGCAAGGTGCACATCTTTCAGAGCTCGCATATACAACGAGACCAACATTGATGCATCATTTGCCAAGGCCAGGCAAAGCAAATGCCCAAGTACCGTTGGCTCAGGAGACAACAACCTT
GCACCTTTGGACGTCCAAACTCCCAACACTTTTGACACTGCTTACTTCAAGAACCTCATCAACCAAAAGGGCCTCCTCCACTCTGACCAAATTCTCTACAACAATGGTGGATCCACAGAT
TCATTGGTTAAAACGTACAGCGGCAGTGCCAATACCTTCAATTCTGACTTTGCCAAGGCAATGATCAAGATGGGAGATAATAAGCCACTCACTGGATCCAACGGTGAGATTAGATTGAAC
TGTAGGAGGCCTAACTAG

Retrieve as FASTA