Entry information : PpePrx23 (ppa008666m)
Entry ID 9272
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx23 (ppa008666m)
Name (synonym) PpePrx23 (ppa008666m)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx23
start..stop
S start..stop
PtPrx83 525 0 22..333 30..338
VvPrx15 509 0 3..332 5..331
GmPrx105 501 0 3..333 5..332
MtPrx90 501 1e-180 26..332 26..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4836801..4837013 213 N° 2 4836372..4836563 192 N° 3 4836066..4836231 166 N° 4 4835522..4835952 431
complement(join(4835522..4835952,4836066..4836231,4836372..4836563,4836801..4837 013))


exon

Literature and cross-references PpePrx23 (ppa008666m)
DNA ref. Phytozome 12:   scaffold_5 (4837013..4835522)
Protein sequence: PpePrx23 (ppa008666m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (314)
PWM (Da):   %s   37290.87 (35041.7)  
PI (pH):   %s   7.76 (7.12) Peptide Signal:   %s   cut: 20 range:20-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRMFLIVLTMVFHGTGTSVEDDGPLFLDYYKEKCPLAEEIVRRSVAIAVAKDPRMAASLLRLHFHDCFVMGCDASVLLDSYGGIVSEKQAGPNLDSLRGFEVVDEIKYHLEEACPTTVSCADILALAARDAVALRGGPSWNVWLGRRDSLEASFSGANQFIPAPNSSLETLIANFKQQGLDVGDLVALSGSHTMGRARCLSFRQRVYDVNFRGKYELYDKYKRYTTFRRMLRSICPKSGRDDELAPLDFQTPARFDNHYYLNILQGKGLLGSDNVLVTQDHDGEILKQVWAYASDQKLFFASFVKSVIKMGNINTLTGNQGEIRKHCRFVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (A very short 5' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGGATGTTCTTGATAGTACTAACAATGGTTTTTCATGGCACTGGAACTTCTGTTGAGGATGATGGACCTCTATTTCTTGACTATTACAAAGAAAAGTGCCCTTTGGCAGAAGAG
ATTGTGAGGCGTAGTGTTGCAATTGCGGTGGCTAAAGATCCTCGAATGGCGGCTTCACTCCTTCGCTTGCATTTTCATGATTGTTTTGTTATG
GTTGAGNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNGCACACGCGCACACACACAAACACACACGGAGCCAAATTTGCTGACTTTGGTTTTGCAAGTTTGTCTTCCCTTGTACCAGTCAGTGCATGCATACTGCAGGGGAGAGAC
ACAGCAATATCATAAATATGAAACAAGAATCAATACTATACTTCGATCTTCTTGTTTTGTTGTTAACAGTTTTTGTTTCTTTGGAGTTAGGGGTGCGATGCATCTGTTCTTTTGGACAGC
TATGGAGGCATAGTCAGTGAAAAGCAAGCCGGCCCAAACCTAGATTCTTTACGAGGATTTGAGGTTGTCGATGAGATAAAGTATCACCTGGAAGAGGCTTGTCCAACAACAGTTTCATGT
GCTGATATTCTAGCCTTGGCTGCTCGCGATGCTGTTGCATTG
GTACATCTCTGTCTCGATGTTGTCCATAAGAGATGTGATCAGAAATAATGTCCTCACTAAATTTGATACATGTAGCAT
CACTCTCTCAAAAATTGTAAGTATTTTGTAACATTTTTCGTTTTTCTTCTGTTGGTGAAAAGAGAGGTGGACCAAGCTGGAATGTGTGGCTAGGCAGGAGAGACTCACTGGAAGCAAGCT
TCAGTGGTGCCAACCAGTTCATCCCCGCTCCAAATTCCTCTCTAGAAACTCTCATTGCCAATTTCAAACAACAGGGCCTTGATGTAGGAGACTTGGTTGCCTTGTCAG
GTAAGTTATTCA
AGAATCAATATCATGTGAAAAATATGCCNNNNNNNNNNNNNNNNNNNNNNNNCAATGAAATTACTATTAAATGATAGGACTTACAAAGGGTAGATCTGCAGGTAGCCACACAATGGGAAG
GGCAAGATGTTTAAGTTTCAGACAGAGGGTGTATGATGTAAACTTCAGAGGAAAATACGAATTATACGATAAATACAAGAGATATACGACCTTTCGAAGAATGCTACGGTCCATATGCCC
GAAATCAGGGAGGGACGATGAATTAGCACCGCTTGATTTTCAGACACCAGCCAGATTTGACAACCATTACTACCTTAACATACTCCAAGGGAAAGGTTTATTGGGGTCTGATAATGTGTT
GGTCACACAAGATCATGACGGGGAGATACTAAAGCAGGTGTGGGCTTATGCCTCTGATCAAAAGCTTTTCTTTGCTTCATTTGTAAAATCAGTGATCAAGATGGGAAATATCAATACATT
GACTGGAAACCAAGGAGAGATCAGGAAGCATTGTAGGTTTGTCAATGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGGATGTTCTTGATAGTACTAACAATGGTTTTTCATGGCACTGGAACTTCTGTTGAGGATGATGGACCTCTATTTCTTGACTATTACAAAGAAAAGTGCCCTTTGGCAGAAGAG
ATTGTGAGGCGTAGTGTTGCAATTGCGGTGGCTAAAGATCCTCGAATGGCGGCTTCACTCCTTCGCTTGCATTTTCATGATTGTTTTGTTATG
GGGTGCGATGCATCTGTTCTTTTGGAC
AGCTATGGAGGCATAGTCAGTGAAAAGCAAGCCGGCCCAAACCTAGATTCTTTACGAGGATTTGAGGTTGTCGATGAGATAAAGTATCACCTGGAAGAGGCTTGTCCAACAACAGTTTCA
TGTGCTGATATTCTAGCCTTGGCTGCTCGCGATGCTGTTGCATTG
AGAGGTGGACCAAGCTGGAATGTGTGGCTAGGCAGGAGAGACTCACTGGAAGCAAGCTTCAGTGGTGCCAACCAG
TTCATCCCCGCTCCAAATTCCTCTCTAGAAACTCTCATTGCCAATTTCAAACAACAGGGCCTTGATGTAGGAGACTTGGTTGCCTTGTCAG
GTAGCCACACAATGGGAAGGGCAAGATGT
TTAAGTTTCAGACAGAGGGTGTATGATGTAAACTTCAGAGGAAAATACGAATTATACGATAAATACAAGAGATATACGACCTTTCGAAGAATGCTACGGTCCATATGCCCGAAATCAGGG
AGGGACGATGAATTAGCACCGCTTGATTTTCAGACACCAGCCAGATTTGACAACCATTACTACCTTAACATACTCCAAGGGAAAGGTTTATTGGGGTCTGATAATGTGTTGGTCACACAA
GATCATGACGGGGAGATACTAAAGCAGGTGTGGGCTTATGCCTCTGATCAAAAGCTTTTCTTTGCTTCATTTGTAAAATCAGTGATCAAGATGGGAAATATCAATACATTGACTGGAAAC
CAAGGAGAGATCAGGAAGCATTGTAGGTTTGTCAATGCCTAG

Retrieve as FASTA