Entry information : PpePrx29 (ppa008820m)
Entry ID 9276
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx29 (ppa008820m)
Name (synonym) PpePrx29 (ppa008820m)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx29
start..stop
S start..stop
LcPrx01 488 6e-176 1..318 1..317
MePrx35 481 5e-173 1..318 1..316
CclPrx48 471 3e-169 2..318 3..319
CsPrx07 471 3e-169 2..318 3..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23443860..23444069 210 N° 2 23443560..23443751 192 N° 3 23443305..23443470 166 N° 4 23442801..23443189 389
complement(join(23442801..23443189,23443305..23443470,23443560..23443751,2344386 0..23444069))


exon

Literature and cross-references PpePrx29 (ppa008820m)
DNA ref. Phytozome 12:   scaffold_2 (23444069..23442801)
Protein sequence: PpePrx29 (ppa008820m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   34483.57 (31853.2)  
PI (pH):   %s   8.56 (8.57) Peptide Signal:   %s   cut: 24 range:24-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNYSLLLLFLVFAGTFLETKGKLTPKFYSSKCPKALSIVQEEVVAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSSFVGEKTAAPNNNSIRGFEVVDHIKAKLEKACPGVVSCADLLALAARDSVVYLGGPSWKVRLGRRDSTTASRSAANTSIPPPTSNISSLISNFAAQNLSLRDLVALSGSHTIGLARCTSFRSRIYNESTIDAAFANSLQGSCPRSGNDDNLANLDHQTPTHFDNLYYKNLLKVKGLLHSDQELFNGTSSADKLVKIYANNTFAFFEHFAKAMINMGNIEPLTGSQGEIRTNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAAATTACAGCTTGCTGCTGCTTTTCTTGGTCTTTGCTGGTACATTTCTTGAAACCAAAGGCAAGCTCACTCCAAAATTCTACTCATCTAAATGCCCAAAAGCACTGTCCATT
GTGCAAGAAGAAGTTGTAGCAGCCATAAAAAACGAAACACGCATCGGAGCTTCCTTGCTCCGCCTTCATTTCCATGATTGCTTTGTAAAT
GTGAGTCACCACTAATGTTAATATATATAT
ATATAGCTACACTTGCATTCTGCTCATTCTGCCTTTCTTAACAAAAGGGTTTGGCTTAATGTCTTTGACAAATTTCAGGGCTGCGATGCGTCGGTGCTGTTGGACGATACATCAAGCTTT
GTAGGTGAGAAAACCGCAGCTCCTAATAACAACTCCATCAGAGGATTTGAAGTTGTTGATCACATCAAAGCCAAGCTTGAGAAGGCATGCCCCGGAGTGGTGTCATGTGCTGATCTTCTA
GCTCTGGCTGCACGCGACTCTGTAGTTTAT
GTAAGAAAACGATCTTAATTTCTTCCTCCAAAACCTCGAATTTCCATGTAACGTGGTCATTATCTTCTTCATTGGCATTTGATTCACAGT
TAGGAGGCCCTTCATGGAAAGTTCGCTTGGGAAGAAGAGATTCTACAACTGCTAGCAGAAGTGCTGCCAACACCTCCATCCCTCCACCAACTTCCAATATAAGCAGTCTCATTTCAAACT
TTGCTGCACAAAATCTCTCCTTAAGAGACTTGGTCGCTCTTTCAG
GTTAGAAAAATTCAATCTTTCGACATAAATCATAGCTGAAAAGGAATGCCAAATATTAAGACAAACAGAACAAGG
GTTTGCTCAGGCTCACTTGAGTTGTTTATGGCATTGGCAGGTTCACACACCATTGGCCTGGCAAGATGCACATCATTCCGGTCACGCATCTACAATGAGTCCACCATCGACGCCGCCTTT
GCCAATTCATTGCAGGGCAGTTGTCCGAGAAGCGGAAATGATGACAACCTTGCAAATCTTGACCACCAGACCCCAACACATTTTGATAACTTGTATTACAAGAATTTGCTCAAAGTAAAG
GGTCTTCTTCATTCAGACCAGGAGCTCTTCAATGGAACTTCTTCTGCAGATAAACTGGTTAAAATATATGCAAACAACACCTTTGCATTCTTCGAGCACTTTGCCAAGGCCATGATCAAT
ATGGGAAACATCGAGCCTCTCACAGGAAGCCAGGGCGAGATAAGAACCAATTGCAGAAAAGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAAATTACAGCTTGCTGCTGCTTTTCTTGGTCTTTGCTGGTACATTTCTTGAAACCAAAGGCAAGCTCACTCCAAAATTCTACTCATCTAAATGCCCAAAAGCACTGTCCATT
GTGCAAGAAGAAGTTGTAGCAGCCATAAAAAACGAAACACGCATCGGAGCTTCCTTGCTCCGCCTTCATTTCCATGATTGCTTTGTAAAT
GGCTGCGATGCGTCGGTGCTGTTGGACGAT
ACATCAAGCTTTGTAGGTGAGAAAACCGCAGCTCCTAATAACAACTCCATCAGAGGATTTGAAGTTGTTGATCACATCAAAGCCAAGCTTGAGAAGGCATGCCCCGGAGTGGTGTCATGT
GCTGATCTTCTAGCTCTGGCTGCACGCGACTCTGTAGTTTAT
TTAGGAGGCCCTTCATGGAAAGTTCGCTTGGGAAGAAGAGATTCTACAACTGCTAGCAGAAGTGCTGCCAACACCTCC
ATCCCTCCACCAACTTCCAATATAAGCAGTCTCATTTCAAACTTTGCTGCACAAAATCTCTCCTTAAGAGACTTGGTCGCTCTTTCAG
GTTCACACACCATTGGCCTGGCAAGATGCACA
TCATTCCGGTCACGCATCTACAATGAGTCCACCATCGACGCCGCCTTTGCCAATTCATTGCAGGGCAGTTGTCCGAGAAGCGGAAATGATGACAACCTTGCAAATCTTGACCACCAGACC
CCAACACATTTTGATAACTTGTATTACAAGAATTTGCTCAAAGTAAAGGGTCTTCTTCATTCAGACCAGGAGCTCTTCAATGGAACTTCTTCTGCAGATAAACTGGTTAAAATATATGCA
AACAACACCTTTGCATTCTTCGAGCACTTTGCCAAGGCCATGATCAATATGGGAAACATCGAGCCTCTCACAGGAAGCCAGGGCGAGATAAGAACCAATTGCAGAAAAGTCAATTAA

Retrieve as FASTA