Entry information : PpePrx32 (ppa009513m)
Entry ID 9279
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx32 (ppa009513m)
Name (synonym) PpePrx32 (ppa009513m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx32
start..stop
S start..stop
CpapPrx12 470 6e-167 14..316 1..308
EcamPrx48 464 2e-166 20..318 21..322
EgrPrx48 464 3e-166 20..318 21..322
MePrx102 461 3e-165 4..316 3..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2481816..2482016 201 N° 2 2480971..2481726 756  
complement(join(2480971..2481726,2481816..2482016))


exon

Literature and cross-references PpePrx32 (ppa009513m)
DNA ref. Phytozome 11:   scaffold_7 (2482016..2480971)
Protein sequence: PpePrx32 (ppa009513m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (298)
PWM (Da):   %s   33952.41 (31693.0)  
PI (pH):   %s   8.21 (7.70) Peptide Signal:   %s   cut: 21 range:21-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIIKTSLLAFFFLLPLVLADLRVGFYNATCPQAESIIQQVVQKQFATDSSITGGLLRMHFHDCFVRGCDASILIDSTPKKPSEKSAGPNLTVRGFELIDEAKKRLEAACPSTVSCADIITLATRDSVVLAGGQSYAAPTGRRDGLVSNPNDVNLPGPSFSVSQALQAFTAKGLTLNDMVTLLGAHTVGLVHCNFFQDRLSNFQGTGSPDPSMDPALVAKLSKLCASGNNPTTFLDQNTSSTFDNQYYNQLLLKRGILQIDQELASDRSTTGIVSGFASNGVRFSQSFATAIVKLGSLQVLVGNAGEIRKNCRVFNPK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (There is a short sequence in frame missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCATTAAGACTTCATTGCTAGCCTTCTTCTTTCTTCTTCCTCTTGTACTGGCTGACCTGCGGGTTGGTTTCTACAATGCTACCTGCCCACAAGCTGAATCAATTATACAACAA
GTCGTGCAAAAACAGTTCGCAACTGATTCATCCATAACTGGCGGTTTGCTTCGCATGCATTTTCACGACTGCTTTGTCAGA
GTACGCTACATTAATTCTTATACATGGTTAAGTTGATAT
ATATATAATATGTGTGTGTGTATAATTAATGAACTTTATATGTATTGCAGGGATGTGATGCCTCCATACTTATAGATTCGACACCGAAGAAGCCATCTGAAAAATCGGCAGGACCAAACT
TGACTGTGCGAGGATTTGAGCTTATTGACGAGGCCAAGAAACGCCTAGAGGCAGCATGCCCTTCAACTGTATCCTGTGCAGATATCATAACCCTCGCAACCCGAGATTCAGTTGTTCTTG
CGGGAGGGCAAAGCTACGCTGCTCCCACCGGAAGGCGTGATGGCCTTGTTTCAAATCCCAACGACGTTAACTTGCCCGGTCCATCGTTCTCCGTGTCTCAGGCGTTGCAGGCTTTCACAG
CCAAAGGGTTGACCCTAAATGACATGGTCACTCTTTTGGGTGCACACACGGTTGGTTTAGTGCACTGTAATTTTTTCCAAGATAGGCTCTCAAATTTTCAAGGCACAGGGTCTCCTGATC
CTTCTATGGATCCAGCCTTGGTTGCCAAGCTGAGCAAACTTTGTGCATCTGGCAATAACCCAACTACATTTCTGGACCAAAATACATCTTCTACTTTTGATAACCAGTACTACAATCAGC
TTCTTTTGAAGAGAGGTATCTTGCAGATCGACCAGGAGCTTGCTTCAGATAGATCTACGACTGGTATTGTTTCTGGATTTGCATCAAATGGTGTGAGATTCAGTCAGAGCTTTGCAACTG
CTATAGTAAAGTTGGGGAGTCTCCAGGTTCTTGTCGGAAATGCCGGAGAAATTAGGAAAAATTGTAGAGTTTTTAATCCCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCATTAAGACTTCATTGCTAGCCTTCTTCTTTCTTCTTCCTCTTGTACTGGCTGACCTGCGGGTTGGTTTCTACAATGCTACCTGCCCACAAGCTGAATCAATTATACAACAA
GTCGTGCAAAAACAGTTCGCAACTGATTCATCCATAACTGGCGGTTTGCTTCGCATGCATTTTCACGACTGCTTTGTCAGA
GGATGTGATGCCTCCATACTTATAGATTCGACACCGAAG
AAGCCATCTGAAAAATCGGCAGGACCAAACTTGACTGTGCGAGGATTTGAGCTTATTGACGAGGCCAAGAAACGCCTAGAGGCAGCATGCCCTTCAACTGTATCCTGTGCAGATATCATA
ACCCTCGCAACCCGAGATTCAGTTGTTCTTGCGGGAGGGCAAAGCTACGCTGCTCCCACCGGAAGGCGTGATGGCCTTGTTTCAAATCCCAACGACGTTAACTTGCCCGGTCCATCGTTC
TCCGTGTCTCAGGCGTTGCAGGCTTTCACAGCCAAAGGGTTGACCCTAAATGACATGGTCACTCTTTTGGGTGCACACACGGTTGGTTTAGTGCACTGTAATTTTTTCCAAGATAGGCTC
TCAAATTTTCAAGGCACAGGGTCTCCTGATCCTTCTATGGATCCAGCCTTGGTTGCCAAGCTGAGCAAACTTTGTGCATCTGGCAATAACCCAACTACATTTCTGGACCAAAATACATCT
TCTACTTTTGATAACCAGTACTACAATCAGCTTCTTTTGAAGAGAGGTATCTTGCAGATCGACCAGGAGCTTGCTTCAGATAGATCTACGACTGGTATTGTTTCTGGATTTGCATCAAAT
GGTGTGAGATTCAGTCAGAGCTTTGCAACTGCTATAGTAAAGTTGGGGAGTCTCCAGGTTCTTGTCGGAAATGCCGGAGAAATTAGGAAAAATTGTAGAGTTTTTAATCCCAAGTAA

Retrieve as FASTA