Entry information : PpePrx41 (ppa014996m)
Entry ID 9282
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx41 (ppa014996m)
Name (synonym) PpePrx41 (ppa014996m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx41
start..stop
S start..stop
VvPrx[P]60 410 5e-145 8..327 6..326
LePrx80 405 5e-143 8..328 4..325
MePrx105 394 2e-138 36..327 56..344
AfpPrx14 393 4e-138 14..328 12..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10877248..10877466 219 N° 2 10877690..10877881 192 N° 3 10878082..10878247 166 N° 4 10878381..10878796 416
join(10877248..10877466,10877690..10877881,10878082..10878247,10878381..10878796 )


exon

Literature and cross-references PpePrx41 (ppa014996m)
DNA ref. Phytozome 11:   scaffold_1 (10877248..10878796)
Protein sequence: PpePrx41 (ppa014996m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35643.43 (32804.9)  
PI (pH):   %s   8.96 (9.10) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLVNLNVVFLSLLVLIEVVSVCNGRVLSPAFYRKSCPQIGRIVRSITWSKVAANPTLAAKLLRLHYHDCFVRGCDASILIDSTSGNTAEKDAIPNRSIGGYDVIDEIKTKLEEECLDIVSCADIVALAARDAVSYQFGRPMWQVLTGRKDGRVSLASEASRDLPSGNANFTTLQQQFAGLGLNIIDLVALSGAHTIGVAHCAVFQRRLNATGKGDADPSLDPEYAQFLRTQCTTPPNPAVAVALDANSSVSFDSHYFAGLRHNKGLLRSDAALLTDPRSARVVKSFQGFHVFMANFGLSMKKMGAIGVKKGARDDGEIRKNCRVVNAAN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTGTCAATTTAAATGTTGTGTTTCTTTCTCTTCTTGTGCTCATAGAGGTTGTTAGTGTTTGCAATGGACGTGTCCTGAGCCCGGCCTTCTATCGCAAGAGCTGCCCTCAAATT
GGAAGAATAGTGAGGAGCATTACATGGAGCAAGGTTGCAGCAAATCCTACCTTGGCAGCCAAGCTTCTAAGGCTCCACTACCATGATTGCTTTGTTAGG
GTATACTTAATTTTAAGCACT
ATCACTTTATACATCATTAACACTTATAAGTAGATAATACACGTCACTAATTATATACTAATTTGTACGTATGTGACGTCTCTTAACGTTGTTGATTGAATTGACTTTAGCGGACAGTCA
GTTTAATCTACGGTTCACAATGACCTATCATGCACCCTTCATTAATTTTTCCTACATGCATACCTATGTTGTTTGTTTGTAGGGATGTGATGCATCAATATTGATAGACTCAACGAGTGG
TAACACGGCGGAAAAGGATGCAATACCAAACAGGTCCATTGGAGGTTATGATGTTATTGATGAAATCAAAACCAAATTAGAAGAAGAATGTCTCGACATCGTCTCATGTGCTGATATTGT
TGCCTTGGCTGCCAGGGATGCAGTTTCTTACCAA
GTACGTGCCATGCACACTAAAATCATTTCTAATTTTATGAAGAAAAAAAATACATTTAAGTGCACAGTTACGAAANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNCATGTCATATAGTGTTACGAATCCACACATTATTTTTTTCTCCGTCTTCTTTCTCTTGTAAGATTTCATATCCTTCATGGCGCTTGTGCAGTTTGGG
AGGCCCATGTGGCAGGTTTTGACCGGCAGAAAAGATGGAAGAGTCTCACTTGCCTCAGAGGCTTCAAGGGACTTGCCCTCCGGAAATGCAAACTTCACCACCCTCCAACAGCAATTTGCT
GGTCTTGGCCTAAACATCATAGATCTTGTCGCCTTATCAG
GTATATATATATATAGATATAAGTTATATAACAAGCTAGACAGATATAAGAATCTGAATTCCGCTTTCAAAAATGGTTTA
AACTAACTGATCAGACTGTGTGACAAAAGAAAGTTAATTTCAAAATTTTGTAGGGGCACATACAATTGGAGTGGCACATTGCGCTGTATTTCAAAGGAGACTGAATGCGACAGGCAAAGG
TGACGCCGACCCTTCACTTGATCCAGAATACGCACAGTTCTTGAGAACGCAATGCACCACCCCGCCTAACCCGGCGGTCGCAGTGGCATTGGACGCCAACAGCTCAGTTTCCTTTGACAG
CCATTACTTTGCGGGTTTGAGGCACAACAAAGGGCTCTTGAGATCAGATGCAGCCCTACTCACTGACCCACGTTCGGCTAGAGTTGTAAAAAGCTTTCAAGGGTTCCACGTTTTCATGGC
TAACTTTGGGCTTTCAATGAAGAAAATGGGTGCCATTGGTGTCAAAAAAGGTGCCCGGGATGATGGAGAGATTAGGAAGAATTGCAGGGTTGTTAATGCAGCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTTGTCAATTTAAATGTTGTGTTTCTTTCTCTTCTTGTGCTCATAGAGGTTGTTAGTGTTTGCAATGGACGTGTCCTGAGCCCGGCCTTCTATCGCAAGAGCTGCCCTCAAATT
GGAAGAATAGTGAGGAGCATTACATGGAGCAAGGTTGCAGCAAATCCTACCTTGGCAGCCAAGCTTCTAAGGCTCCACTACCATGATTGCTTTGTTAGG
GGATGTGATGCATCAATATTG
ATAGACTCAACGAGTGGTAACACGGCGGAAAAGGATGCAATACCAAACAGGTCCATTGGAGGTTATGATGTTATTGATGAAATCAAAACCAAATTAGAAGAAGAATGTCTCGACATCGTC
TCATGTGCTGATATTGTTGCCTTGGCTGCCAGGGATGCAGTTTCTTACCAA
TTTGGGAGGCCCATGTGGCAGGTTTTGACCGGCAGAAAAGATGGAAGAGTCTCACTTGCCTCAGAGGCT
TCAAGGGACTTGCCCTCCGGAAATGCAAACTTCACCACCCTCCAACAGCAATTTGCTGGTCTTGGCCTAAACATCATAGATCTTGTCGCCTTATCAG
GGGCACATACAATTGGAGTGGCA
CATTGCGCTGTATTTCAAAGGAGACTGAATGCGACAGGCAAAGGTGACGCCGACCCTTCACTTGATCCAGAATACGCACAGTTCTTGAGAACGCAATGCACCACCCCGCCTAACCCGGCG
GTCGCAGTGGCATTGGACGCCAACAGCTCAGTTTCCTTTGACAGCCATTACTTTGCGGGTTTGAGGCACAACAAAGGGCTCTTGAGATCAGATGCAGCCCTACTCACTGACCCACGTTCG
GCTAGAGTTGTAAAAAGCTTTCAAGGGTTCCACGTTTTCATGGCTAACTTTGGGCTTTCAATGAAGAAAATGGGTGCCATTGGTGTCAAAAAAGGTGCCCGGGATGATGGAGAGATTAGG
AAGAATTGCAGGGTTGTTAATGCAGCTAATTAA

Retrieve as FASTA