Entry information : PpePrx47 (ppa017084m)
Entry ID 9287
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx47 (ppa017084m)
Name (synonym) PpePrx47 (ppa017084m)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx47
start..stop
S start..stop
RcPrx49 560 0 12..351 16..352
CppPrx08 560 0 23..352 26..354
CsPrx13 559 0 12..352 17..355
CclPrx92 558 0 17..352 23..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2688981..2689256 276 N° 2 2688650..2688853 204 N° 3 2687816..2688397 582  
complement(join(2687816..2688397,2688650..2688853,2688981..2689256))


exon

Literature and cross-references PpePrx47 (ppa017084m)
DNA ref. Phytozome 12:   scaffold_4 (2689256..2687816)
Protein sequence: PpePrx47 (ppa017084m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354
PWM (Da):   %s   38812.89 Transmb domain:   %s   o10-32i
PI (pH):   %s   9.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVLTSSSSSSFTYISLSIFLLLILYNTTVICSATTRTKTTHPNRQLSVNYYAKSCPQVEQLIGSITSQQFKESPVSGPATIRLFFHDCFVEGCDASIIISSKQQGNKMLAEKDAPDNKDLREEGFESVRKAKAVVESKCPGVVSCADILAISARDYVHLAGGPYYQVKKGRWDGKISMASKVASNIPQANFTVDQLLKLFSSKGLTLEDLVVLSGAHTFGFAHCQNFVSRLYDYRGSKQPDPVIDPRLLRALRMSCPHYGGNADIVAPFDVTTPFVFDHAYYGNLEAKLGLLASDQALSLDPRTKPIVQALAKDKQKFFQAFAAAMEKMGSIGVKRGRKHGEKRKDCSTHML*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTCCTTACCTCTTCTTCTTCTTCCTCTTTTACATACATTTCTTTGTCCATTTTCTTGCTGCTCATTCTGTACAACACCACTGTCATTTGTTCAGCTACAACCAGGACCAAGACG
ACTCACCCAAACCGCCAACTCTCTGTTAATTACTATGCCAAATCATGTCCTCAAGTTGAGCAGCTCATCGGCTCCATCACATCCCAACAGTTCAAAGAATCACCTGTTTCCGGCCCGGCA
ACCATTCGCCTTTTCTTCCATGACTGCTTTGTTGAA
GTAATCACAACTCCATCTAACAATGCACATTGGTTTGGTTTAAATTTTCTACATGCACGTGCATTTTAATGTATTAATTTTTGT
CAGTCTGTCTCTTTTGACAATTTTGGGTTCGAATATATTGAAGGGTTGTGATGCATCGATAATCATAAGCTCAAAGCAGCAGGGGAACAAAATGTTGGCAGAGAAGGATGCACCTGATAA
CAAGGACCTGAGAGAAGAAGGCTTTGAAAGTGTGAGGAAGGCCAAAGCTGTTGTGGAGAGCAAGTGTCCTGGTGTTGTGTCTTGTGCAGACATACTTGCAATTTCAGCCAGAGATTATGT
CCACTTG
GTAAGTGCCAAAGATTCTCTGCCTTTGCCTTCTAATCTATAATGCTGCAATGTGGACCTGTAATGCCATGCTTTTGACACTCCCAATTTAGCTCCCGGCACTCCTCCAAATCG
AGTATTTTATAATTTGTATGTACACACATTGTGCCGGAAACTAAAGCGAGAGGGTGGAAGTGTCAAAATCATTACCCTTTTAATTTTACATGCGTATTGACATTTTTTTTCTAATTTGAA
TTTCAATGGGGGCGGGCAGGCAGGGGGTCCATACTATCAAGTTAAGAAAGGGAGGTGGGATGGGAAAATATCAATGGCCTCAAAAGTGGCCTCAAATATTCCCCAAGCAAATTTCACAGT
GGATCAGCTACTCAAACTCTTCAGTTCAAAAGGCCTAACACTTGAAGACCTGGTTGTTCTTTCTGGTGCACATACCTTCGGCTTTGCTCATTGCCAGAACTTTGTAAGCAGGCTCTATGA
CTACAGGGGATCCAAGCAGCCCGACCCGGTTATCGACCCGAGACTCCTGAGGGCCCTAAGAATGTCATGCCCACATTATGGTGGAAATGCTGACATCGTTGCACCATTTGATGTCACCAC
ACCGTTTGTGTTTGACCATGCCTATTATGGGAACCTAGAGGCTAAGTTGGGCTTGCTAGCATCAGACCAAGCTTTATCTTTGGACCCAAGAACCAAGCCTATTGTCCAGGCGTTGGCAAA
AGATAAGCAAAAGTTCTTTCAAGCTTTTGCTGCAGCAATGGAGAAAATGGGCTCAATAGGTGTGAAAAGAGGAAGAAAACATGGGGAGAAAAGGAAAGACTGTAGTACGCATATGTTATG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTCCTTACCTCTTCTTCTTCTTCCTCTTTTACATACATTTCTTTGTCCATTTTCTTGCTGCTCATTCTGTACAACACCACTGTCATTTGTTCAGCTACAACCAGGACCAAGACG
ACTCACCCAAACCGCCAACTCTCTGTTAATTACTATGCCAAATCATGTCCTCAAGTTGAGCAGCTCATCGGCTCCATCACATCCCAACAGTTCAAAGAATCACCTGTTTCCGGCCCGGCA
ACCATTCGCCTTTTCTTCCATGACTGCTTTGTTGAA
GGTTGTGATGCATCGATAATCATAAGCTCAAAGCAGCAGGGGAACAAAATGTTGGCAGAGAAGGATGCACCTGATAACAAGGAC
CTGAGAGAAGAAGGCTTTGAAAGTGTGAGGAAGGCCAAAGCTGTTGTGGAGAGCAAGTGTCCTGGTGTTGTGTCTTGTGCAGACATACTTGCAATTTCAGCCAGAGATTATGTCCACTTG
GCAGGGGGTCCATACTATCAAGTTAAGAAAGGGAGGTGGGATGGGAAAATATCAATGGCCTCAAAAGTGGCCTCAAATATTCCCCAAGCAAATTTCACAGTGGATCAGCTACTCAAACTC
TTCAGTTCAAAAGGCCTAACACTTGAAGACCTGGTTGTTCTTTCTGGTGCACATACCTTCGGCTTTGCTCATTGCCAGAACTTTGTAAGCAGGCTCTATGACTACAGGGGATCCAAGCAG
CCCGACCCGGTTATCGACCCGAGACTCCTGAGGGCCCTAAGAATGTCATGCCCACATTATGGTGGAAATGCTGACATCGTTGCACCATTTGATGTCACCACACCGTTTGTGTTTGACCAT
GCCTATTATGGGAACCTAGAGGCTAAGTTGGGCTTGCTAGCATCAGACCAAGCTTTATCTTTGGACCCAAGAACCAAGCCTATTGTCCAGGCGTTGGCAAAAGATAAGCAAAAGTTCTTT
CAAGCTTTTGCTGCAGCAATGGAGAAAATGGGCTCAATAGGTGTGAAAAGAGGAAGAAAACATGGGGAGAAAAGGAAAGACTGTAGTACGCATATGTTATGA

Retrieve as FASTA