Entry information : PpePrx51 (ppa018664m)
Entry ID 9291
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx51 (ppa018664m)
Name (synonym) PpePrx51 (ppa018664m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx51
start..stop
S start..stop
CclPrx113 495 1e-178 1..319 1..318
VvPrx35 482 2e-173 9..319 16..326
RcPrx52 480 7e-173 10..319 8..317
CclPrx84 478 4e-172 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1958340..1958552 213 N° 2 1958960..1959151 192 N° 3 1959255..1959420 166 N° 4 1959562..1959950 389
join(1958340..1958552,1958960..1959151,1959255..1959420,1959562..1959950)


exon

Literature and cross-references PpePrx51 (ppa018664m)
DNA ref. Phytozome 12:   scaffold_6 (1958340..1959950)
Protein sequence: PpePrx51 (ppa018664m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (295)
PWM (Da):   %s   34731.1 (31772.6)  
PI (pH):   %s   6.76 (6.01) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFISHYNRFCFFVLLMLLRIASAQLSSDYYATTCPRALSVVRSSVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSNFTGEKTALPNVRSLRGFEVIDTIKSQLESLCPGVVSCADILAVAARDSVLLFGGPSWTVQLGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAKEMVALSGSHTMGQARCQMFRDRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNAYFKNLVDSKGLLHSDQQLFSGGSTDSLVTTYSNSSGTFYTDFANAMLKMGNLSPLTGTSGQIRTNCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Bad prediction at 5' end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATCTCACACTATAACAGATTCTGCTTCTTTGTGCTTTTGATGCTGCTTAGGATAGCATCTGCACAATTGTCCTCGGATTATTATGCAACAACGTGCCCCCGAGCCCTTTCT
GTCGTTCGGAGTTCAGTTATTAATGCGGTGGTGAAGGAGCATCGGATGGGGGCGTCCTTGCTCCGTCTCCATTTCCATGATTGCTTTGTTAAT
GCATGTCCTTTCCTACCCTCCCTCCTT
TCCCAGCAAGTTTATATTTGATTGAGCTAGTACTTGTCACTGTGTTTTAATTTCATATATGTTAGGAATTGTGTGAAATGTTGTCCAGAACTAGCTGAAATGACCAGAGAGAGCACCCTT
CGTGGCAGTATGACTCAATAAGAGAGCAGCATACACAACTTTGTTCTTTGTAGTTATAATTTACACATATTTGGCTGCAACTTCATGTAATAAATATACTTGTTGTAGAAAGAAGCTAGG
AAGCTTTGCCTGCATATGAACAATTACAAAAGGATTAATTTATTGTGTTCTTTAAGTTCATTAACATAAATATAAATCACAAACAAAATCCTTCTTGGTCATTATTAATATTGATGAATT
TTTCGTATGGTTTTCAACAGGGATGTGATGCATCTGTATTATTAGACGACACTTCAAATTTCACTGGGGAAAAGACAGCTTTACCAAATGTAAGATCATTGAGGGGATTCGAAGTGATAG
ATACTATAAAATCTCAGCTAGAAAGTCTCTGCCCCGGTGTTGTTTCGTGTGCAGATATCCTTGCCGTTGCAGCCCGCGATTCAGTTCTTTTA
GTAAGTCACATTTTATGCCTAAAAGAAA
GAGTGGAAGTCATGAAAGTTGAAAGGAATAAGTAATTGCTGTATAGTTAGATGATGTTAATTTATGTTTATGCAGTTTGGTGGCCCTTCATGGACAGTTCAGTTGGGCAGAAGAGACTCA
ACCACAGCAAGTTTAAGTGATGCAAATACTGAACTCCCATCTCCAAGCCTAGATCTTAAAGACCTCATCTCTTCGTTCTCAACTAAAGGATTTAGTGCCAAAGAAATGGTGGCTCTCTCT
G
GTAAGTACATAACATAAAAAGCAACAAAGTATTTGGGTACTTCTTGAAATTTCAATTACTTGACTTCCAAGAAATTATATTTGATTCACTTACTTGCATAATCTGTCTCCTCTAATGAA
AATCATTCATGTTTATGACTAGGATCTCACACAATGGGTCAAGCCAGGTGTCAAATGTTCCGAGACAGAATATATAATGAGACTAACATCAATTCAGAATTTGCTACCTTCTTGAAATCA
AACTGTACTCAGAGCTCTGGGACTGATGACAACCTTTCTCCACTGGATATTACAAGCCCGGTTTTCTTTGATAACGCTTATTTCAAGAACTTGGTGGATAGCAAGGGTCTCTTGCATTCT
GATCAGCAACTTTTCAGTGGTGGTTCAACAGACTCTCTGGTTACCACTTATAGCAACAGCTCTGGAACTTTTTATACAGATTTTGCCAATGCCATGTTGAAAATGGGGAACCTTAGCCCG
CTTACAGGAACTAGCGGTCAAATTCGTACCAACTGTCGCAAAACAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATCTCACACTATAACAGATTCTGCTTCTTTGTGCTTTTGATGCTGCTTAGGATAGCATCTGCACAATTGTCCTCGGATTATTATGCAACAACGTGCCCCCGAGCCCTTTCT
GTCGTTCGGAGTTCAGTTATTAATGCGGTGGTGAAGGAGCATCGGATGGGGGCGTCCTTGCTCCGTCTCCATTTCCATGATTGCTTTGTTAAT
GGATGTGATGCATCTGTATTATTAGAC
GACACTTCAAATTTCACTGGGGAAAAGACAGCTTTACCAAATGTAAGATCATTGAGGGGATTCGAAGTGATAGATACTATAAAATCTCAGCTAGAAAGTCTCTGCCCCGGTGTTGTTTCG
TGTGCAGATATCCTTGCCGTTGCAGCCCGCGATTCAGTTCTTTTA
TTTGGTGGCCCTTCATGGACAGTTCAGTTGGGCAGAAGAGACTCAACCACAGCAAGTTTAAGTGATGCAAATACT
GAACTCCCATCTCCAAGCCTAGATCTTAAAGACCTCATCTCTTCGTTCTCAACTAAAGGATTTAGTGCCAAAGAAATGGTGGCTCTCTCTG
GATCTCACACAATGGGTCAAGCCAGGTGT
CAAATGTTCCGAGACAGAATATATAATGAGACTAACATCAATTCAGAATTTGCTACCTTCTTGAAATCAAACTGTACTCAGAGCTCTGGGACTGATGACAACCTTTCTCCACTGGATATT
ACAAGCCCGGTTTTCTTTGATAACGCTTATTTCAAGAACTTGGTGGATAGCAAGGGTCTCTTGCATTCTGATCAGCAACTTTTCAGTGGTGGTTCAACAGACTCTCTGGTTACCACTTAT
AGCAACAGCTCTGGAACTTTTTATACAGATTTTGCCAATGCCATGTTGAAAATGGGGAACCTTAGCCCGCTTACAGGAACTAGCGGTCAAATTCGTACCAACTGTCGCAAAACAAATTGA

Retrieve as FASTA