Entry information : PpePrx52 (ppa018671m)
Entry ID 9292
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: PpePrx52 (ppa018671m)
Name (synonym) PpePrx52 (ppa018671m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx52
start..stop
S start..stop
PpePrx25 549 0 1..316 1..315
FvPrx17-1A 549 0 12..316 15..319
FvPrx17-1B 546 0 1..316 1..316
PpePrx27 539 0 1..316 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18064648..18064842 195 N° 2 18064932..18065123 192 N° 3 18065315..18065881 567  
join(18064648..18064842,18064932..18065123,18065315..18065881)


exon

Literature and cross-references PpePrx52 (ppa018671m)
DNA ref. Phytozome 12:   scaffold_6 (18064648..18065881)
Protein sequence: PpePrx52 (ppa018671m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (300)
PWM (Da):   %s   34766.67 (32823.6)  
PI (pH):   %s   7.31 (7.24) Peptide Signal:   %s   cut: 18 range:18-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLVSLFLLHIVTASATQLHPGYYLGTCPKAEIIVRDVMKKAFTRDPRSLASIMRFQFHDCFVNGCDASLLLDDTPTMLGEKLSLSNINSLRSYEVIDEAKAALEKACPGIVSCADVIIMASRDAVALTGGPDWQVKLGRLDSLTASQEASDNVMPSPTSNATFLIDLFGKFDLSVKDLVALSGSHSIGKARCFSVMSRLYNQSGTGRADPAFEPKFREKLNKLCPLDVDQNVTVGLDASPVVFDNQYFKDLVSGRGFLNSDQTLYTFPQTRGLVKQFSINQGVFFKAFVEGMLKMGDLKVDQPGEVRKNCRVVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATATACAT TCATTGCTTT TCTTTTAAAT TTTTTTAAAA AAAAAAAAGA AAAAAAATGA AAAAAGGAAT TCATTGATAA CAATTAAGAG GATGCATACA ACAATATCAT CTTGTACAAC  TAGCTCAAGA AGCTCTTCAA TCCAAGTTGC AATAGAATTA CAATTAAGTG TTAGAAGATG AGCTACTTGA TTGCACCTTC TAGACTTAAT GAAACAATAA TTAACATAAT CAAATTGTTG  CAGACTCCTC TTAATATCAT CAATGAGAAG CCCATCTGAT ACCAATGACT CTTTTTCACC ATTCTTTAAG TCATTTACCA CTACTTGCAA ATCAAACTCA ACCAATATGC AAAAACTAAA  ATGTCTAGCA TGAGTAGGCC AAAGTTTCCT ATAATATGTC ATACTCTAAG TTATATTTAG TTTACATAAC TTCCCACAGT TTATAAAATT TTGAGTAAAT GCACAATCTC TAATAAGATC  CCAACATCAC ATGTGTTTTT CTTTAATTTC TGCTTTTTTG TTCTCACGTT CAAAGTATGT GTTGATTAAT GAACACAAGA GTGAGGTGGC TGGCACTTCG TGCAGTGCAG ACTTCAAATG  GCTTAGAAAT TTTTGTTTCA ACCCATAAAT AGTCAAAATA ATAATGGCCA TCAAAATCAA AACATCTCTT TTTTTCTTAT ATATAGAAAT TATAGGATTG CATTCTTAAT TCAACCAAAA  AAGTCACTAG TCATAAAAGG GTCAATGCAA ACTAGCTACA AATGGCTATT ACAATAACGG AGCGGTCTAC CATCAAAATT AAGACAATCT GGTGCGCTTC CACTAATGAT CACGCAGGAT  TGAAGAAACT CTTGCATAGG CATCCCAACT AAGATTGCAT ACTCAAAATA ATCAAAACGT AATAAAGCTT TTAAAAACCA AGCCATAACA ATACGAATAA AACTCTCACA AAGGAGAGAT  GAAAAGCTCT CACAAATGAG AGGTGAAAAG CTCTTACAAA GGAGAGTTGA AAAGCTCTCA CAAAGGAGAG GTGAAAACTA CACAGAAAAC CAAAAGAGTC TCTATGACTT ATTCTGAACA  TAAAGAAACC GCAAAAAGGA TGGTGGTGGA GATTCGACAT TGAAATGCAG GTGGAGATCC GACGTCGAGA CGGAGCTGCC TGTGATTGTT GGAAGAAAAT CATAACAAAA CGAAGACAAA  TAGGAAAAAC CTTTTGTCTC TGAAAATGAG GGAAGAAGAG AGGGAGTAAG AGAATATGGG AAAGAGGAGG AAGAACAATG GCTTCCTCCC CCCTAAAAGG TAAAAACGAC TCTAGAATGG  TTTTTTGGGA GCAAAATCAA AACATCTCTA ATTATGCCAT AAACTCAACC GTTTGAAATT AGGGAGATTC ACTATTATAC CCAATATGGG GGCCCAAATT ATAAAAATAT CCTATATAAA  ATGGACTTTA GAAACACACC TAAAGCCCAT TTACAACATA ACAAAAAAGC TTTTAACTTC TTATAAATTA CAAAACTGCC ATCAATTTCT TAAAACAAGC CCAACCCCAA AATCTCATAA  AAATACTCAA AGCACTCAAT AGGGCATCAA AGTAATTTAA TAATCAATAT TAAATTCAAT AAGGCCAGCT ATCATTTTTT GGGTCTTTTT TGGGTTTGTT TATAGGAATT CAATTGTGTA  GGGTTTATTT ATAATATTAG TGCTAGAAAT GGGTATATCA CTAAATATCT CTTAAAATTA ATTGCATTCC ATCTTGCCAA AAATCAGAAA AAGACAGAGG GAAAGAACCA CTCTTGATTT  TTGTGAGAAG CGCGAAAGAA CCATTTCACA TCCATTGCTT CTATTAATTT CTATACATGC ACATGAGGGC ATTCCACGAC TTTAAAAACC CCCCCATACA CAACTTGAAG TGCACCAATT 
CTTCGTCCAA AAAAAGAAGT GCACCAATTC AATTTCATCC TCACCTTCAC ACTAGCAACT AGTGCCTCAA AAAATTATCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTGTTTCACTCTTCCTCCTACACATAGTAACCGCGTCCGCCACCCAACTACACCCCGGTTATTACTTGGGAACGTGCCCAAAAGCCGAAATCATAGTCCGAGATGTCATG
AAGAAGGCTTTCACCAGAGATCCCCGGAGTCTTGCTTCAATCATGCGCTTCCAATTCCATGATTGCTTTGTTAAT
GTAAATAAAACTATATATACAAAGTAAAATTGTATATTTCCTTAT
AATCATTATTCTTTAACAACTGATTTGTTAATGCTTCATATTAGGGTTGTGACGCTTCTTTGTTACTTGATGACACACCGACCATGCTAGGAGAAAAACTCAGCCTCTCAAATATAAATT
CACTAAGATCTTATGAAGTTATTGATGAAGCCAAGGCAGCCTTGGAGAAGGCCTGTCCCGGAATTGTTTCTTGCGCTGATGTCATAATCATGGCTTCTAGAGATGCTGTTGCCCTG
GTAT
ATTAAACTCTCTTATCAATATTACATGGACTTACTTTGAGGCCAACGTTAATATTAACTTGTACGACCATTGTATTGAACCGTATTCCACTGGACGAGTACGTACACTCTACTATATACG
TACTAGTCCAATACAATGTATAAAGAAAAGTGTTATTTTAGTACTAACTTAATTTTTCCTTGATTAGACTGGAGGACCAGATTGGCAAGTGAAGTTAGGAAGATTGGATAGCTTGACAGC
GAGCCAAGAAGCCTCAGACAATGTCATGCCAAGTCCAACATCCAATGCAACCTTCCTCATAGACCTCTTTGGCAAATTCGATCTCTCTGTCAAAGACCTTGTTGCCCTTTCGGGCTCACA
CTCCATTGGCAAAGCTCGGTGCTTCTCCGTCATGTCTCGGTTGTACAACCAATCCGGCACGGGCCGGGCAGACCCTGCCTTTGAACCGAAGTTTAGAGAAAAGCTAAACAAGCTTTGTCC
CTTAGATGTGGACCAAAACGTTACCGTAGGACTTGATGCGTCACCTGTTGTGTTTGATAACCAGTACTTCAAGGACTTGGTTTCAGGGAGAGGGTTTCTGAATTCGGATCAAACACTTTA
TACATTTCCACAGACTAGAGGACTTGTGAAGCAGTTCAGCATTAACCAAGGAGTATTTTTCAAGGCCTTTGTGGAGGGAATGTTAAAGATGGGTGACTTGAAGGTGGATCAGCCTGGGGA
GGTGAGAAAGAATTGCAGGGTGGTTAATTATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTGTTTCACTCTTCCTCCTACACATAGTAACCGCGTCCGCCACCCAACTACACCCCGGTTATTACTTGGGAACGTGCCCAAAAGCCGAAATCATAGTCCGAGATGTCATG
AAGAAGGCTTTCACCAGAGATCCCCGGAGTCTTGCTTCAATCATGCGCTTCCAATTCCATGATTGCTTTGTTAAT
GGTTGTGACGCTTCTTTGTTACTTGATGACACACCGACCATGCTA
GGAGAAAAACTCAGCCTCTCAAATATAAATTCACTAAGATCTTATGAAGTTATTGATGAAGCCAAGGCAGCCTTGGAGAAGGCCTGTCCCGGAATTGTTTCTTGCGCTGATGTCATAATC
ATGGCTTCTAGAGATGCTGTTGCCCTG
ACTGGAGGACCAGATTGGCAAGTGAAGTTAGGAAGATTGGATAGCTTGACAGCGAGCCAAGAAGCCTCAGACAATGTCATGCCAAGTCCAACA
TCCAATGCAACCTTCCTCATAGACCTCTTTGGCAAATTCGATCTCTCTGTCAAAGACCTTGTTGCCCTTTCGGGCTCACACTCCATTGGCAAAGCTCGGTGCTTCTCCGTCATGTCTCGG
TTGTACAACCAATCCGGCACGGGCCGGGCAGACCCTGCCTTTGAACCGAAGTTTAGAGAAAAGCTAAACAAGCTTTGTCCCTTAGATGTGGACCAAAACGTTACCGTAGGACTTGATGCG
TCACCTGTTGTGTTTGATAACCAGTACTTCAAGGACTTGGTTTCAGGGAGAGGGTTTCTGAATTCGGATCAAACACTTTATACATTTCCACAGACTAGAGGACTTGTGAAGCAGTTCAGC
ATTAACCAAGGAGTATTTTTCAAGGCCTTTGTGGAGGGAATGTTAAAGATGGGTGACTTGAAGGTGGATCAGCCTGGGGAGGTGAGAAAGAATTGCAGGGTGGTTAATTATTAG

Retrieve as FASTA