Entry information : PpePrx53 (ppa018701m)
Entry ID 9293
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx53 (ppa018701m)
Name (synonym) PpePrx53 (ppa018701m)
Class Class III peroxidase    [Orthogroup: Prx201]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx53
start..stop
S start..stop
PpePrx57 652 0 1..329 1..330
PpePrx55 580 0 1..329 1..330
PpePrx54 444 4e-158 1..329 1..322
PpePrx43 442 1e-157 13..329 7..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1970724..1970960 237 N° 2 1970042..1970240 199 N° 3 1968496..1969049 554  
complement(join(1968496..1969049,1970042..1970240,1970724..1970960))


exon

Literature and cross-references PpePrx53 (ppa018701m)
DNA ref. Phytozome 12:   scaffold_6 (1970960..1968496)
Protein sequence: PpePrx53 (ppa018701m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   35845.67 (33490.5) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.76 (4.67) Peptide Signal:   %s   cut: 33 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAANSHQPVWVLFTTFVVAAAIVLAPATCTAQLTRDFYQQSCPQALQIIRSVVNGAINRETRMGASLLRLHFHDCFVNGCDGSILLDDTDNFTGEKTASANLNSVRGFDVIDEIKATLNTYCNGNVVSCADILAVAARDSVEIVSPSYSYEVQLGRRDATTAVLNDANRNIPPPTFDFSQLLSIFQSHGLGLQDLILLSGGHTIGLARCTTFRDRIYNDTNIDPEFAASLREGCPANGGDDNTTPIDSTTTQFDTVYFKSLLQKKGLFHSDQELFKSDGSDSDNLVQHYANSPEDFKVDFGASMIKMGNINPLTGYAGEIRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCTAATTCTCATCAACCTGTCTGGGTTTTGTTCACTACTTTTGTTGTTGCAGCTGCTATTGTGCTGGCCCCAGCTACATGCACTGCTCAACTCACTCGTGATTTCTATCAG
CAGTCCTGCCCTCAGGCATTGCAAATCATCAGATCAGTTGTCAACGGAGCTATTAATCGGGAGACGCGCATGGGAGCGTCGCTCCTACGCTTGCACTTCCATGACTGCTTTGTCAAT
GTA
GGTTTCATTTTGTGGCTGTGTTCAATAACTTCTTTTTTTGTTATTTCTTGTATACAAACAGAGCCATACTTTTCCTCAAGGTAGCTGAATACTGTCTGTTGTCAGACTCTGAATCTGAAG
CATTGATCATATGAATACTTATTTGAATGAGTGTTACAAAACCAAACACTTTTAGAGTGTGTGTGGTCGAGGTAGCAGAATATTTTGTTGATTATGTTGACCGACTGTGAATATGAACCA
TTAATTATATGAATACTTATTTGCATGAGTGTTACAAAACCAAACCAAAGGTTGAGTAACTTTAGAGCGTGCAAGGTTGAGGAATAAATATCACTACTTTAGAAACTGTACAGTTTTTAC
CTAACAAGAAAGGAGATAGTTGTTTAACACAGCGTTTTTTGAATTATTACATACGTTCAAAAAACTTTAATGAAGATTTTAATACTGGAACATTGACTATGGTTTCCATCTTGGTGGCAG

GGGTGTGATGGATCGATTTTGCTGGACGACACAGATAACTTCACTGGTGAGAAGACGGCCAGCGCGAATCTGAACTCCGTTAGAGGTTTTGATGTGATTGATGAAATTAAAGCAACCCTC
AATACATATTGCAATGGCAATGTGGTCTCATGTGCTGATATCTTAGCAGTTGCAGCTCGTGACTCGGTTGAGATTGTAA
GTGTTAAGAAAAGCCTTCGATGTCTAACTTGTCTAAAAAGG
CTTTTTCTAGCCATTTTATATTTTGCATGTTGTGTTGTTAATTAATAACAAATGAGTGTTTCTAAATGAACTCTAAAATTAACTGAGTACACCCTACTATCAAACTATTTATTGAATTAC
TAATTTACCATAATATAAAATGACAAAAAATAAAATTAAGGTGTACTCAATTAATTTTAAGATTCGTTTAGCTTTTTTTTCTCTTATGTCCTCTGCCTAATGGTTTCCTGCAAGTTAAAG
ATATAATTAGAAAGAAAAGATGATTGTTGTTCAAAATTAATAGGATTATATCCATCCTCAACCAAACCTCAAATAATTAATTGTGGAAATTTTAAAATGGTTGGTTTTTAACAAGTCAAA
AGTAGATTTTTGTTGTAGTCTCCTCTGCTTGATCTACATAGTACTGTAAATTCATACATCAATTCGCTATGTGAGTCCATCAATGGTGAGGCCCTATTGTCAACAATTGAGTACAAAATG
CGTTTTGGAGTACAAGTTTCCATCTTGGACAAAAAACAACCCAATATTTTACATTGTTACTGCCTTAGCTAAAAGAAATTTGAGAATTTTCGCACAAAATATTGGCCGATTTGAATTTGT
TTCTTTAAATTTCAAAGGAGATCTATCAAAAGAAAATTTTGGGTTCTGGGTACTTACTATCGGCCGTTGCAGATTGTCAAAGAAAGAGAGAGTGACGACATTGTTCAGTAATACTAATTT
ACCCTAATATAAAAATGACCAAAAAGTATTAGTGTGTAGTAGGGGTATTTTGGTAGTTAATTAGGGTGTACTTAGTTAATTTTACATTTTGATTTAAATATTATGATGTACTTAAATTAT
AAGGTGTACTCAGTTAATTTTAAAGTTCGTTTAGCAGTACTCTAACAAATTAGCCTAATTAAAAATGGATAAATTAGTCCAACTCTTGTGCTGCTTGTGTTTAGCTGGGAGGCCCTTCCT
ATTCCTATGAAGTACAATTGGGTAGAAGAGATGCAACAACTGCAGTCTTGAATGATGCAAACAGAAATATTCCTCCTCCAACTTTCGACTTCTCTCAGCTTCTCTCCATCTTTCAATCTC
ATGGTCTAGGCCTGCAAGATCTGATCCTCCTCTCAGGGGGCCACACCATTGGACTAGCTAGGTGCACGACCTTCAGAGACAGGATTTACAATGACACCAATATAGACCCTGAGTTTGCAG
CTTCCTTGCGAGAGGGTTGTCCTGCAAATGGTGGAGACGACAACACGACGCCAATAGACTCAACCACAACGCAGTTTGATACCGTGTACTTCAAGTCTTTGCTGCAGAAAAAAGGTCTCT
TCCATTCTGATCAGGAGCTCTTTAAAAGTGATGGCAGTGATAGCGATAATCTGGTGCAGCATTACGCTAACAGCCCCGAGGATTTCAAAGTAGATTTTGGGGCTTCCATGATCAAGATGG
GTAACATAAACCCCCTCACTGGATATGCTGGTGAGATAAGGCTCAATTGCAGGAAAATCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCTAATTCTCATCAACCTGTCTGGGTTTTGTTCACTACTTTTGTTGTTGCAGCTGCTATTGTGCTGGCCCCAGCTACATGCACTGCTCAACTCACTCGTGATTTCTATCAG
CAGTCCTGCCCTCAGGCATTGCAAATCATCAGATCAGTTGTCAACGGAGCTATTAATCGGGAGACGCGCATGGGAGCGTCGCTCCTACGCTTGCACTTCCATGACTGCTTTGTCAAT
GGG
TGTGATGGATCGATTTTGCTGGACGACACAGATAACTTCACTGGTGAGAAGACGGCCAGCGCGAATCTGAACTCCGTTAGAGGTTTTGATGTGATTGATGAAATTAAAGCAACCCTCAAT
ACATATTGCAATGGCAATGTGGTCTCATGTGCTGATATCTTAGCAGTTGCAGCTCGTGACTCGGTTGAGATTGTAA
GCCCTTCCTATTCCTATGAAGTACAATTGGGTAGAAGAGATGCA
ACAACTGCAGTCTTGAATGATGCAAACAGAAATATTCCTCCTCCAACTTTCGACTTCTCTCAGCTTCTCTCCATCTTTCAATCTCATGGTCTAGGCCTGCAAGATCTGATCCTCCTCTCA
GGGGGCCACACCATTGGACTAGCTAGGTGCACGACCTTCAGAGACAGGATTTACAATGACACCAATATAGACCCTGAGTTTGCAGCTTCCTTGCGAGAGGGTTGTCCTGCAAATGGTGGA
GACGACAACACGACGCCAATAGACTCAACCACAACGCAGTTTGATACCGTGTACTTCAAGTCTTTGCTGCAGAAAAAAGGTCTCTTCCATTCTGATCAGGAGCTCTTTAAAAGTGATGGC
AGTGATAGCGATAATCTGGTGCAGCATTACGCTAACAGCCCCGAGGATTTCAAAGTAGATTTTGGGGCTTCCATGATCAAGATGGGTAACATAAACCCCCTCACTGGATATGCTGGTGAG
ATAAGGCTCAATTGCAGGAAAATCAACTAG

Retrieve as FASTA