Entry information : PpePrx54 (ppa018750m)
Entry ID 9294
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx54 (ppa018750m)
Name (synonym) PpePrx54 (ppa018750m)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx54
start..stop
S start..stop
PpePrx43 557 0 1..322 1..320
PtPrx39 481 6e-173 1..322 1..319
PpePrx55 466 5e-167 7..322 11..330
CsaPrx10 459 1e-164 9..322 8..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2000487..2000705 219 N° 2 2000820..2001014 195 N° 3 2001212..2001766 555  
join(2000487..2000705,2000820..2001014,2001212..2001766)


exon

Literature and cross-references PpePrx54 (ppa018750m)
DNA ref. Phytozome 12:   scaffold_6 (2000487..2001766)
Protein sequence: PpePrx54 (ppa018750m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (304)
PWM (Da):   %s   35284.08 (33266.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.55 (9.54) Peptide Signal:   %s   cut: 19 range:19-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALRSFLVIICFVVVAATSMMPTSAQLSSGFYNKVCPQALPAIRKVVKRAISHEPRIGASLLRLHFHDCFVNGCDGSVLLDDTANFTGEKTAFPNLNSIRGFNVIDDIKKAVDKACYKSVVSCADILAVAARDSVSILGGPDYEVQLGRRDARTASVNDANRNLPPPVFSFSQLLSNFQAHGLNLKDLIVLSAAHTIGLARCTTFRARIYNDTNIDPKFAASAKYNCPTTGGDNNTRPLDSTTRRFDNVYFKALLQQKGLLHSDQELYKNNGTDSDKLVLKYSRNSESFAKDFANSMIKMGNIKPLTGNNGEVRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGATCTTTCCTCGTGATCATCTGTTTTGTAGTGGTAGCTGCCACTAGTATGATGCCAACATCTGCACAACTAAGTTCTGGTTTCTACAACAAAGTGTGCCCTCAGGCA
CTGCCAGCTATCAGAAAAGTCGTCAAACGGGCCATCAGCCATGAGCCACGCATCGGAGCCTCTCTACTTCGCCTTCATTTCCATGACTGCTTTGTTAAT
GTAATTAAGCTTATATTGATT
GTGCATGCATATAGTGCACTTGAAATAGTTGTTCACGTAAATTATCAGTTCTAATTTTTTTCCTGATATATGTTCATGGTTGAATTGATACAGGGTTGCGATGGATCGGTTCTGCTTGAT
GACACTGCCAACTTCACCGGTGAGAAGACTGCCTTCCCAAATCTGAATTCGATCCGGGGATTCAACGTCATCGATGATATCAAAAAAGCTGTCGACAAAGCTTGCTACAAGAGTGTGGTC
TCATGTGCAGATATATTAGCTGTTGCAGCTCGTGATTCTGTATCCATT
GTGAGTATATACATGTTTGCTAATATTGCTAGGTTCATCAAATGTGTTCACCAAATATTGTCCCAGTATACG
TTCCAGTTTCATACTAAACCCTAATATTCATTTGGCAGACAAATTTGGTGATCCTAAGAGTACTCGTTTTCTTTCGACATGGAATGAAATGATTTTAAAAATGAAATTTTGTGTTTGTGT
TTTAGTTGGGAGGACCTGATTACGAAGTACAATTAGGAAGAAGGGATGCAAGAACTGCAAGCGTGAATGATGCAAACAGAAATCTTCCACCCCCAGTCTTCAGCTTCTCACAGCTTCTTT
CTAACTTCCAAGCTCATGGACTTAACCTTAAAGACTTGATTGTGCTCTCAGCTGCCCACACCATTGGACTTGCTCGGTGTACCACCTTCCGTGCCAGGATTTACAATGATACCAACATAG
ACCCCAAGTTTGCAGCCTCTGCAAAATACAATTGTCCAACAACTGGAGGAGACAACAACACAAGGCCACTAGATTCAACTACAAGGCGATTCGATAACGTCTACTTTAAGGCTTTGTTAC
AACAAAAGGGTCTCCTCCATTCTGATCAAGAGCTCTATAAAAATAATGGTACAGATAGTGATAAGCTGGTGCTGAAATACAGCAGGAACTCGGAATCTTTTGCAAAAGACTTTGCAAATT
CTATGATCAAGATGGGCAACATCAAGCCTCTCACTGGGAATAATGGAGAAGTAAGACTCAACTGCCGGAAAATCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGATCTTTCCTCGTGATCATCTGTTTTGTAGTGGTAGCTGCCACTAGTATGATGCCAACATCTGCACAACTAAGTTCTGGTTTCTACAACAAAGTGTGCCCTCAGGCA
CTGCCAGCTATCAGAAAAGTCGTCAAACGGGCCATCAGCCATGAGCCACGCATCGGAGCCTCTCTACTTCGCCTTCATTTCCATGACTGCTTTGTTAAT
GGTTGCGATGGATCGGTTCTG
CTTGATGACACTGCCAACTTCACCGGTGAGAAGACTGCCTTCCCAAATCTGAATTCGATCCGGGGATTCAACGTCATCGATGATATCAAAAAAGCTGTCGACAAAGCTTGCTACAAGAGT
GTGGTCTCATGTGCAGATATATTAGCTGTTGCAGCTCGTGATTCTGTATCCATT
TTGGGAGGACCTGATTACGAAGTACAATTAGGAAGAAGGGATGCAAGAACTGCAAGCGTGAATGAT
GCAAACAGAAATCTTCCACCCCCAGTCTTCAGCTTCTCACAGCTTCTTTCTAACTTCCAAGCTCATGGACTTAACCTTAAAGACTTGATTGTGCTCTCAGCTGCCCACACCATTGGACTT
GCTCGGTGTACCACCTTCCGTGCCAGGATTTACAATGATACCAACATAGACCCCAAGTTTGCAGCCTCTGCAAAATACAATTGTCCAACAACTGGAGGAGACAACAACACAAGGCCACTA
GATTCAACTACAAGGCGATTCGATAACGTCTACTTTAAGGCTTTGTTACAACAAAAGGGTCTCCTCCATTCTGATCAAGAGCTCTATAAAAATAATGGTACAGATAGTGATAAGCTGGTG
CTGAAATACAGCAGGAACTCGGAATCTTTTGCAAAAGACTTTGCAAATTCTATGATCAAGATGGGCAACATCAAGCCTCTCACTGGGAATAATGGAGAAGTAAGACTCAACTGCCGGAAA
ATCAATTAG

Retrieve as FASTA