Entry information : PpePrx56 (ppa019052m)
Entry ID 9296
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-16 (Qiang Li)
Peroxidase information: PpePrx56 (ppa019052m)
Name (synonym) PpePrx56 (ppa019052m)
Class Class III peroxidase     [Orthogroup: Prx023]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpePrx56
start..stop
S start..stop
MePrx135 452 2e-161 1..325 1..327
GrPrx41 449 4e-160 4..325 8..331
PtPrx97 439 2e-156 18..325 1..308
PpePrx79 437 1e-155 1..325 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4246816..4247031 216 N° 2 4247158..4247340 183 N° 3 4247720..4247885 166 N° 4 4248017..4248429 413
join(4246816..4247031,4247158..4247340,4247720..4247885,4248017..4248429)


exon

Literature and cross-references PpePrx56 (ppa019052m)
DNA ref. Phytozome 12:   scaffold_6 (4246816..4248429)
Protein sequence: PpePrx56 (ppa019052m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   35808.06 (32710.6)  
PI (pH):   %s   7.34 (6.98) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRFNEYNSLFFVINLFMLCSAVRSDLNADFYKQTCPDLLKIVRKEVKDALKIEMRMAASLLRLHFVDCFVNGCDASILLDGSNSEKFATPNLNSVRGFQVVDAVKSAVESACSGVVSCADILALIARDSVLLSGGPTWKVLLGRRDGLVPNQRGANLAIPSQYDTLDTIISKFANVGLNVTDVVSLSGAHTIGQARCATFSKRLWNFFNTGGPDSTMEKDMLSDLRHVCLVNGDGNETTALDRNSNDLFDNHYYQNLLDGKGLLHSDQILFNGGDDETKSVVDNYRRKPKLFFDDFIKSMIKMGNIGPVTGSSGQIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAGATTTAATGAATATAACAGTTTATTTTTTGTCATAAATCTGTTCATGTTGTGTTCAGCTGTGAGGTCTGATCTTAATGCAGATTTCTATAAGCAGACATGTCCAGATCTTCTC
AAAATCGTCAGGAAAGAGGTCAAAGATGCACTAAAGATTGAAATGCGAATGGCGGCTTCCTTGCTTCGGCTTCACTTTGTCGATTGCTTTGTGAAT
GTGAGTTGAAAACATTACTAAAAA
TAATTAGCAATATTTTGGTACCTTGATTTAGGCTTAATGTTTAGGCTAACTTCTTTTACATGCCTTTTTATGCTTTCCAACAATCCCAATCATTTTTCTTAGGGCTGTGATGCATCAATT
CTGTTGGATGGAAGCAACAGTGAGAAATTTGCTACTCCCAATTTGAACTCTGTTAGAGGATTTCAAGTGGTGGATGCAGTCAAAAGTGCTGTGGAGAGTGCATGCAGTGGAGTTGTATCC
TGTGCTGATATATTAGCCCTAATTGCCCGGGATTCTGTTCTGTTG
GTAAGTGTTCATCTTTGGTTTCTCTTGTTTACAAAAAAATGATCATCATTTGCAAGAGACTTGTAGCTCAAGTGC
TATTAACTCTACAGTTGAGATCTTGTGTGTTGAATCTCTTTGTAAGTTTTCATCTTCGGTATCTCTTGTTTACGAAAAATGTGATCACCCTTTGTAAGGCTTATAGCTCAAGTGCTCTTA
AACCTTGCACCCACCCGAAGCCTTATATCTCTTGTTTTAAAAAGGAAATATTGTATCACATTTGAATGTGACAAAGGCCATTGAAATCATTTGAGTCATTTCAGCAACATCAAAAAGTCA
TCTTAATTATCCAGATCTAAGTAGAAGTTGATGACGGATGAAACTAAGAGCTCAAAATGTGCAGAGTGGAGGACCAACATGGAAGGTTTTATTGGGAAGAAGGGATGGACTGGTGCCAAA
CCAGAGAGGAGCAAATCTTGCTATTCCTTCTCAATATGACACACTGGACACAATAATTTCAAAATTTGCCAATGTAGGTCTCAATGTCACAGATGTGGTCTCCTTGTCAG
GTACATAACC
TAAAAATCTATATAATTATTGTTAATGTCACAGATTTGGCCATATATGCTTTTAGTTTAATTTAGACTTAGCATGGTAGTAAATTAAATCAATGAAGGGGGGGTTCATTTGGCATGTGTA
GGTGCTCATACAATTGGACAAGCAAGGTGTGCCACTTTCAGCAAGAGACTCTGGAACTTCTTCAACACAGGAGGTCCAGACAGCACAATGGAAAAAGATATGCTATCTGATCTGCGACAT
GTATGTCTCGTGAATGGCGATGGCAACGAAACCACAGCTCTTGATCGAAATTCGAATGATCTCTTTGACAACCATTACTACCAGAACTTGCTCGACGGGAAGGGCCTTCTTCATTCTGAC
CAAATTTTGTTTAATGGTGGTGATGATGAAACCAAAAGTGTTGTTGACAACTACAGAAGAAAGCCTAAACTTTTCTTTGATGACTTTATCAAGTCAATGATCAAGATGGGAAATATTGGC
CCAGTGACTGGATCAAGTGGACAGATTCGAAAGAATTGCAGAGTGATCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAGATTTAATGAATATAACAGTTTATTTTTTGTCATAAATCTGTTCATGTTGTGTTCAGCTGTGAGGTCTGATCTTAATGCAGATTTCTATAAGCAGACATGTCCAGATCTTCTC
AAAATCGTCAGGAAAGAGGTCAAAGATGCACTAAAGATTGAAATGCGAATGGCGGCTTCCTTGCTTCGGCTTCACTTTGTCGATTGCTTTGTGAAT
GGCTGTGATGCATCAATTCTGTTG
GATGGAAGCAACAGTGAGAAATTTGCTACTCCCAATTTGAACTCTGTTAGAGGATTTCAAGTGGTGGATGCAGTCAAAAGTGCTGTGGAGAGTGCATGCAGTGGAGTTGTATCCTGTGCT
GATATATTAGCCCTAATTGCCCGGGATTCTGTTCTGTTG
AGTGGAGGACCAACATGGAAGGTTTTATTGGGAAGAAGGGATGGACTGGTGCCAAACCAGAGAGGAGCAAATCTTGCTATT
CCTTCTCAATATGACACACTGGACACAATAATTTCAAAATTTGCCAATGTAGGTCTCAATGTCACAGATGTGGTCTCCTTGTCAG
GTGCTCATACAATTGGACAAGCAAGGTGTGCCACT
TTCAGCAAGAGACTCTGGAACTTCTTCAACACAGGAGGTCCAGACAGCACAATGGAAAAAGATATGCTATCTGATCTGCGACATGTATGTCTCGTGAATGGCGATGGCAACGAAACCACA
GCTCTTGATCGAAATTCGAATGATCTCTTTGACAACCATTACTACCAGAACTTGCTCGACGGGAAGGGCCTTCTTCATTCTGACCAAATTTTGTTTAATGGTGGTGATGATGAAACCAAA
AGTGTTGTTGACAACTACAGAAGAAAGCCTAAACTTTTCTTTGATGACTTTATCAAGTCAATGATCAAGATGGGAAATATTGGCCCAGTGACTGGATCAAGTGGACAGATTCGAAAGAAT
TGCAGAGTGATCAATTGA

Retrieve as FASTA